KEGG   Francisella sp. TX077308: F7308_1479Help
Entry
F7308_1479        CDS       T01560                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
frt  Francisella sp. TX077308
Pathway
frt00480  Glutathione metabolism
frt00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    F7308_1479
  Metabolism of other amino acids
   00480 Glutathione metabolism
    F7308_1479
Enzymes [BR:frt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     F7308_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-ProteinID: AEI36404
UniProt: F8G8I7
Position
complement(1502698..1503168)
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTKNDGSEYYLPKDKVLLIVNVASKCGFTKQYRGLQHLHKIHPDLEIVAFPCN
SFGGQEPGSDEEIKKFCETNYDVTFPIMKKTKVNGKDAEPIFEYLKDKARGVLGTERIKW
NFTKFLVSKDGETVIRYAPKTIPEDLISDIENFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatttatgactttaaactaactaaaaacgatggttcggaatattatttaccgaaa
gataaagtccttttgatagttaatgttgcaagtaagtgtggttttactaaacaatacagg
ggacttcaacatttgcataaaatacatccggatttagagatagtagctttcccttgtaac
tcattcggggggcaagaacctggtagtgatgaagagattaaaaaattttgtgaaactaac
tatgatgttactttcccaataatgaaaaagacaaaagtaaatggtaaagatgctgaacct
atatttgaatatctcaaggataaggcaagaggcgtactaggtacagaacgtataaaatgg
aattttacaaaatttttagtatcaaaagatggtgagactgtcattagatatgcgcctaaa
acaattcctgaagatctaatatctgatatcgagaattttcttaaagattaa

DBGET integrated database retrieval system