KEGG   Francisella sp. TX077308: F7308_1554Help
Entry
F7308_1554        CDS       T01560                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
frt  Francisella sp. TX077308
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:frt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    F7308_1554
Enzymes [BR:frt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     F7308_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572453..1573106)
Genome map
AA seq 217 aa AA seqDB search
MISFIKGTLIEKDPTALLIDVNGLGYEVFVPMTTFYSLGELNSQISLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVSGIGARTAIAILSGMDSTTLLHCIENKDYGLLATVPGIGKKT
AERLVVEIYDKLLKMANEIYSQSSDTSTNSNTSSAQQSQTPAAISNSIFGESVDALLALG
YKQKDAEKMIRGTIGESTTAAEAIRKALQGSIRSKNK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgattagttttattaaagggactttaatcgaaaaagatccaacagctttacttatagat
gtaaatggtcttgggtatgaggtttttgtaccaatgactacgttttattctttaggagag
ctgaatagccaaattagtctttatactcattttgtagttcgtgaggatgctcaacagtta
tatggctttaaatcaaaagttgataaaaaagtttttcaagagctaataaaagtaagtggt
ataggtgctagaaccgctattgcaatattatctggtatggattctacgacacttctgcat
tgtattgaaaataaagattatggattattagctactgtacctggtattggtaaaaaaacc
gcagaacgtctagttgttgagatttatgacaagctattgaaaatggcaaatgaaatttat
agtcaatcatctgatacatctacaaattcgaatacaagtagtgctcaacagagccaaact
ccagcagctatttcaaactcaatttttggtgaatcagtagatgctcttttagctcttggt
tataaacaaaaagacgcagagaaaatgattcgtggtactattggagaatcaacaacagct
gctgaggcaattcgtaaggctcttcaagggtctataagatcaaaaaataaataa

DBGET integrated database retrieval system