KEGG   Francisella sp. TX077308: F7308_1737Help
Entry
F7308_1737        CDS       T01560                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
frt  Francisella sp. TX077308
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:frt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1769569..1770438
Genome map
AA seq 289 aa AA seqDB search
MLSYSNLNFYSNIKFMPELPEVETVKRGLTKNIINKKIKSIQINTDKLRYPIDKAQLLSL
KSKVVKDVQRRGKHLIIFMEDNLQLIIHLGMSGVVKIINTSEYDKIKHDHIILELSDNLS
LVYNDPRKFGYWLVNTNMMPLEHRVLATHGVEPLTDDFNAEYLISKLKKTSRKIKQTIMD
NSIVVGVGNIYASEALFDSNILPTRASTTITKKEAERLVTSIKKILDKAIAEGGTTLKDY
KNTEGKPGYFTQQLNVYGRANQNCYICSTKIESLVIAQRNTFFCKKCQR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttatcatatagtaatcttaatttttatagtaatattaaatttatgcctgaacttcct
gaagtagagactgtcaaaagaggtttaaccaaaaatattattaacaaaaagattaaaagc
atacagataaatacagataagcttcgctaccccatagataaagctcaacttctatcacta
aaaagtaaagtagtgaaagatgtccaaagaagaggcaaacacctaattatttttatggaa
gataacttgcagttaattattcatcttggtatgtcaggtgttgtcaaaattataaatacc
tctgaatatgataagatcaagcatgaccacattatcttagaattatctgataacctaagt
ctagtctataatgatccgcgtaaatttggatattggttagttaataccaatatgatgcca
ctagaacacagagttttagccactcatggagttgaacctttaacagatgatttcaatgct
gaatatttgatatctaaattaaagaaaacctctagaaagatcaaacaaactatcatggat
aatagcatagttgttggtgtaggaaacatatatgccagtgaagcattatttgatagtaat
atcttacccacaagagcttctaccaccatcacaaaaaaagaagcggagaggcttgtaact
tcaattaagaaaatacttgataaagcaattgccgaaggtggtacaacactcaaggattat
aaaaatacagaaggtaaacctggctacttcacgcaacaactcaatgtttatggcagagcc
aatcaaaactgttacatctgtagtactaaaatcgaaagtttagtgatagcccaaagaaac
acattcttttgtaaaaaatgtcaaagataa

DBGET integrated database retrieval system