KEGG   Francisella sp. TX077308: F7308_1746Help
Entry
F7308_1746        CDS       T01560                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
frt  Francisella sp. TX077308
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F7308_1746
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F7308_1746
   00640 Propanoate metabolism
    F7308_1746
   00660 C5-Branched dibasic acid metabolism
    F7308_1746
Enzymes [BR:frt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     F7308_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1781421..1782584
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAAQAFDQLGGKFAVVKAQVHAGGRGKAGGV
KVVKSSQEAREVAESLIGTNLVTFQTDAEGQPVNSVGVFEDVYPVTRELYLGAVVDRSSR
KVTFMASTEGGVDIEEVAHNTPEKILKVEVDPLVGLQPFQAREVAFKLGLEGKQINDFVK
TMLGAYKAFVECDFALFEINPLAVRENGEIVCVDGKINLDSNALYRHPKLLALRDKSQEN
AKELKASEHELNYVALEGNIGCMVNGAGLAMATMDIIQLYGGKPANFLDVGGGATKERVI
EAFKLILDDENVKAVLINIFGGIVRCDMIAEAIIEAVKEVNVTVPVVVRLEGNNAEKGAK
ILSDSGLKLIPADGLADAADKVVKSLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagctaaagatcttttagaaagctatggtctaaaagttcaa
aaaggtatcgtagctcataacccaaatgaagctgctcaagcatttgaccaacttggtggt
aaatttgctgtggttaaagctcaggtacatgctggtggtcgtggtaaagctggtggtgta
aaagttgttaaatcatctcaagaagctcgtgaagtagcagagagcctaatcggtacaaat
cttgttactttccaaactgatgctgaaggtcagccagttaattctgtaggtgtatttgaa
gatgtataccctgttactcgtgagttatatcttggtgcggtagttgatagatctagccgt
aaagtaacattcatggcttcaactgaaggtggtgtagatattgaagaagtagctcacaac
actccagagaaaatccttaaagtagaagtagatccattagttggtcttcaaccattccaa
gctcgtgaagtagctttcaaacttggtcttgaaggtaagcaaattaatgatttcgttaaa
actatgctaggtgcttacaaagcatttgttgagtgtgattttgcattatttgaaatcaac
cctcttgcagttagagaaaacggcgaaatcgtttgtgttgatggtaaaatcaaccttgat
tcaaacgctctttacagacaccctaaactattagctcttagagacaaatctcaagaaaat
gctaaagaacttaaagcttctgagcatgagctaaactatgtagctcttgaaggtaacatc
ggctgtatggtaaacggtgctggtctagcaatggctactatggatatcatccaattatac
ggtggtaagcctgctaacttcctagatgttggtggtggagctactaaagaaagagtaatc
gaagctttcaaactaatcctagatgatgaaaatgtaaaagctgttttaattaacatcttc
ggtggtatcgtacgttgtgatatgatcgctgaggcaattatcgaagctgttaaagaagta
aatgtaactgtaccagtagttgttcgtctagaaggtaacaatgcagaaaaaggtgctaag
atcctatctgattcaggtttaaaactaatacctgctgatggtttagctgatgctgctgat
aaagttgtaaaatcactaggttaa

DBGET integrated database retrieval system