KEGG   Francisella sp. TX077308: F7308_1806Help
Entry
F7308_1806        CDS       T01560                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
frt  Francisella sp. TX077308
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F7308_1806
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F7308_1806
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    F7308_1806
Enzymes [BR:frt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     F7308_1806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841750..1843033)
Genome map
AA seq 427 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVPQRFPKVDWQSFTKDISYAEFAANTLREF
FKGDQLAASLDKICNNAFTFDVPVKRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKGNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVIDYLNTGEFNPRASVETLANAMD
VGNPSNFERLLYLLGGYENFKANVKAICVSDFEIIEEIKQVYRQYNEVVCPHTATGFVAK
NQLDANKDYIIVATAHPAKFESVIEPVLDIQVPATLALQKLLDKEQYKVVINKSMDELCE
VYTKAFE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtacaagagataaaaatatcaaagtttcattaagtgaggcaatgcag
tctggattagctccagatggaggattatttgtacctcagagatttccaaaggttgattgg
cagagttttaccaaagatatcagctatgctgaatttgctgcaaatactttgagagagttc
tttaaaggagatcagcttgcagcttctttagataagatttgtaataatgcttttactttt
gatgtgccagttaagcgcttggataaaacaacatctgttttagagctttttcatggacca
actttatcttttaaggattttggtgcgagatttttagcaaattgtctaagctctatcgat
agtgagaagccatttacaattttagtagcaacttctggcgatacaggttctgcagtagcg
gcagcttttcacggtaagggtaatattcgtgttatagtgatgttccctaagggtaaaatc
tctaaaagacaagaaaaacaaataacttgctggggcgataatatccaagctgttgaagtt
gaaggagtttttgatgattgtcaaagtttagttaaagaagcttttaagacaccttggtgg
acagaaagaacaaaactaaatacatctaatagtattaatattggtagattattaccgcaa
tctacttactatgcttacacatcgtggcagcattatttacagactggagagaaagcaaac
tacatagttccatctggtaatattggtaatatcacagcagcattttgggctaaacaaatg
ggcttcccaatcggtgagatatctatgagcttaaatgctaatgatacagtgatagattat
ttaaatactggagaatttaacccaagagcaagtgttgagacattggcaaatgcaatggat
gtgggtaatcctagtaattttgaaagacttttatatctgttaggcggttatgagaatttc
aaagcaaatgttaaagctatatgtgtttctgattttgaaatcatagaagaaattaagcaa
gtgtatcgtcagtataatgaagtagtctgtccacatactgcaacaggctttgtagctaaa
aatcagctagatgcaaataaagattatataattgtagcaacagctcaccctgctaagttt
gaaagtgtaattgagccagtattagacatacaagtcccagctactctggcgttacagaag
ctactagataaagaacaatataaagtagtaataaataaatctatggatgagctttgtgag
gtttacacaaaagcttttgaataa

DBGET integrated database retrieval system