KEGG   Francisella sp. TX077308: F7308_1817Help
Entry
F7308_1817        CDS       T01560                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
frt  Francisella sp. TX077308
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F7308_1817
Enzymes [BR:frt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     F7308_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854588..1856012)
Genome map
AA seq 474 aa AA seqDB search
MKKSGLLLAISSLPSQHGIGDLGKSAYEFVDILKQANTKIWQVLPLTPLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEQSSLKSLNVSSDKVEYELVRNFKDKYLEEAFSNFQSSKD
KFEQEYNNFIAQNSWVRNYAIFKAFRKANNNQAWNFWSQEYKNWIKDKAIELDQFQNEID
YQIFLQFIFYKQWFELREYANQNNIEIMGDLPIYLGFDSADVWEHQDIFLLDENLNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKETNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPAGEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLGDLRPEVLELRDHYNLKGMKV
FPFHFDLKTAKFVEGTNIIAYSGTHDNNTLKGWYFDELNRYQRKLLKKYFKANDRNIFRK
IIKYLLNCDAEYVILPVQDVLELDGSARLNTPGTVGSPNWQWKLVDFDLLRTEV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctggattattattagccatatcaagtttaccaagccaacatggtattggt
gatttaggtaaaagtgcttatgaatttgttgatattttaaaacaagcaaatactaaaatt
tggcaggtgttgccacttacaccactaggttttggcaactctccatatcagtcaagctct
tcttttgcaggtgatgaaatctatattagcttagaaaaactagcagattatggtttgctt
gaacaatcatctcttaaaagtttgaatgtaagctctgacaaagttgaatatgaacttgtt
cgtaatttcaaagataagtatctcgaagaagcatttagcaattttcaaagttcaaaagat
aagtttgaacaagaatataataattttatagctcaaaactcatgggttagaaattatgct
atttttaaagcttttagaaaggctaataataaccaggcttggaatttttggtcgcaagaa
tataaaaactggatcaaagataaagctatagaacttgatcaatttcaaaacgagatagat
tatcaaatatttttgcagtttatcttttataagcagtggtttgagctaagagaatatgct
aatcaaaataatatcgaaattatgggtgatttgcctatttatcttggttttgactctgct
gatgtgtgggagcatcaagatatatttctattagacgagaatctaaatcctagttttgtt
gcaggtgttccacctgactttttctcagaaactggtcagctatggggtaatcctctatat
gattgggataagcttaaagaaacaaattttgatttttggatagatcgactaaatggtaac
ttcaagctatttgatatcgttaggattgatcattttagagcttttgatacttactggaaa
ataccagcaggtgaaaagactgctataaatggtgagtgggttgaggctcctggatatgat
ttctttgatacagtttataagcgtattccagatgctaatattattgcagaagatttaggt
gatttacgccctgaagtacttgagttgcgtgatcactataatttaaagggtatgaaagta
ttcccatttcattttgatctaaaaacagctaagtttgttgagggtactaatatcattgca
tactcaggtactcacgataataatactctcaaaggatggtattttgatgaactaaataga
taccaaagaaagctattaaagaaatattttaaagctaatgatagaaatatttttagaaag
attattaagtatttactaaattgtgatgctgaatatgtaatcctgccagtacaagatgtt
ttagaactagatggaagtgcaaggctaaatacacctggtactgttggctcgccaaattgg
caatggaagttggttgattttgacttattaagaacagaagtttag

DBGET integrated database retrieval system