KEGG   Francisella sp. TX077308: F7308_1822Help
Entry
F7308_1822        CDS       T01560                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
frt  Francisella sp. TX077308
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F7308_1822
Enzymes [BR:frt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     F7308_1822
Exosome [BR:frt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F7308_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863319..1865241
Genome map
AA seq 640 aa AA seqDB search
MKNVNSKQNKHSTIGEQDIHYFHEGKHIYAYEFMGAHAACEDGIDGIRFTTWAPNAKSIC
VIGDFSHWEIQSKNQMKPISNSGLWSVFIAGAKNGQKYKLVVTNKDTNHYVYKSDPYAFF
SELRPNTASIINTQMEYKWHDDKWLKKRATDDYYNSPMNIYELHLASWKTKDGEFMSYEE
IAQMLPEYIKDMGYTHVEFMPLHEHPLDASWGYQPTGFYSVNSRHGDLVGLKHLVDKLHT
HDIGVILDWVPGHFCKDQHGLINFDGSACYEYQEPTKAVNEGWGTHNFDLGRNEVKCFLI
SNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIHGGHENLEGIAFLRELNGVLK
HTCKGVITIAEESSSWPNISTPVEQGGLGFDFKWDMGWMNDTLRYISLDPVYRKYHHNLI
TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIF
MGSEFGQFVEWREYEQLQWQVVDEYHTHKETLHFFKKLNDFYKAETALWECDYDHQGFQW
IDANNSEQSILSFVRASKDNQKKLIFVCNFTPVTYYDYNIGVPDAGSYIEAFNSDSLEFG
GSGQVISDEILSVPEAQHGFDQKIAIKIPPMATLVLKLKK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtaaattcaaaacaaaataaacattccactattggcgagcaagatatacat
tacttccatgaaggcaagcacatatatgcatatgaatttatgggtgctcatgcagcctgc
gaagatggtattgatggtattagatttacaacctgggctccaaatgcaaaaagtatttgt
gtcataggtgactttagtcactgggagattcaaagcaaaaatcaaatgaaacccattagt
aattcaggattatggagtgtattcatagctggtgccaaaaatggacaaaaatataaactt
gttgtaacaaataaagatactaatcattacgtttataaaagtgacccttatgcttttttc
tcagaattaagaccgaatacagcatccataataaatactcaaatggaatataaatggcat
gatgacaaatggctaaaaaaacgtgctactgatgactattacaatagtccaatgaatata
tatgaactacatcttgcttcttggaaaaccaaagatggcgaatttatgagttatgaagag
atagcccagatgctgcctgagtatatcaaagatatgggatacacacatgtagagtttatg
ccattacatgaacacccactagatgcttcgtggggttatcaaccaacaggtttttactca
gtgaatagtcgtcatggcgatttagtcggtttgaagcacctagttgataaacttcataca
catgatataggtgtaattttagattgggtaccaggacacttctgcaaagatcaacatgga
ttaatcaactttgatggtagtgcatgttacgaatatcaagaacctaccaaagctgttaac
gaaggttggggaactcataattttgatctgggtagaaatgaagtaaaatgtttcttgatt
tcaaatgcaatgtattggatcaatgagtttcatatagacggacttcgtgtagatgcagta
tcgaatatcttatatcttaactatgatagagaagatggacagtggatacccaacattcat
ggtgggcatgaaaatttggaaggtattgctttcttaagagaactcaatggtgtcctaaag
catacctgcaaaggagtgatcacaattgctgaagaatcatcatcttggccaaatatctcc
acacctgttgagcaaggtggtttagggttcgacttcaaatgggatatgggttggatgaac
gatacattacgctatatctctttagatccagtttatcgtaagtatcatcacaacttaatc
actttctctatggtataccactattcagagaaatttatcttatctatttcacatgacgag
gtagttcacggcaaaaaatctctcataaacaaaatgtggggagacttatggaataaatat
gctggcctacgactatatatgtcatatatgattggtcaccctggtaagaaacttattttt
atgggaagtgaatttggacagtttgttgaatggcgagaatatgagcaattacagtggcag
gttgttgatgaatatcacacacataaagaaacactacatttcttcaaaaaattaaatgac
ttctataaagctgagactgcattgtgggagtgtgattacgatcaccaaggcttccaatgg
attgatgccaacaactctgaacagagtatcttatcttttgtccgagctagtaaagataac
caaaaaaagctaatatttgtttgtaactttactcctgtaacttattacgactacaacata
ggtgttcctgatgcaggatcatatattgaggcttttaattctgacagccttgagtttggt
ggttcaggccaagttatttcagatgaaatactatcagttccagaagcacagcatggcttt
gaccaaaagattgccataaaaatcccgcctatggccacccttgttctcaaactcaaaaaa
taa

DBGET integrated database retrieval system