KEGG   Francisella sp. TX077308: F7308_1922Help
Entry
F7308_1922        CDS       T01560                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
frt  Francisella sp. TX077308
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F7308_1922
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F7308_1922
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F7308_1922
Enzymes [BR:frt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     F7308_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1975566..1976756
Genome map
AA seq 396 aa AA seqDB search
MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADEVFKQEFRELLKEYAGRPTALTK
TRNIVKNTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSANY
NKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQILAKEGRLPDAVIACVGGGSNAIGMF
ADFIDETSVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGMKAPLMQNTDGQIEESYSVS
AGLDFPSVGPQHAHLLAIGRAEYASVTDDEALDSFKLLCKKEGIIPALESSHALAYALKL
AYDNPDKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaaatgcttattttggtgagtatggaggtcaatttgtaccacaaatactt
gtacccgctcttgatcaactagagcaagaatttataaaagcacaagctgatgaggttttt
aaacaggagtttagagagcttttaaaagagtatgcgggcaggcccacagctctgacaaaa
actagaaatatagtcaaaaacacaaaaactaaattatatctaaaacgtgaagatctacta
cacggtggtgctcacaaaactaaccaagtacttggtcaggctctacttgccaagagaatg
ggtaaaaatgagataattgcagaaacaggagctgggcaacatggtgttgctactgctttg
gcttgcgcactacttgatctaaaatgcagagtatatatgggtgctaaagatgtggaacgt
caaagtcccaatgtctttagaatgaagttaatgggtgctgaagtcatacctgtacatagt
ggttcagcaacacttaaagatgcttgtaacgaagcactaagagactggtctgcaaactat
aataaagctcactatttattaggtactgctgcaggacctcacccttttccgacaattgtt
agagagtttcaaagaatgattggtgaagaaaccaagcaacagatccttgccaaggaaggt
agattacctgatgctgtgattgcctgtgttggtggtggttcaaatgctattggaatgttt
gctgattttattgatgaaaccagtgtaaaactgataggtgtagaacctgctggtaaaggt
atcgaaactggtgaacatggagcgcctctcaagcatggtaaaactggtatattttttggc
atgaaagcaccattgatgcaaaatactgatggtcagattgaagaatcatactctgtatca
gccggactagattttccatctgtaggcccacaacatgctcatttactagcaataggacgt
gctgagtatgcttcagtcactgatgatgaggcgttagattcttttaaattgttatgcaaa
aaagaaggaattatccccgctctagaatcatctcatgccttagcatatgctcttaagctt
gcttacgacaatcctgataaagagcaacttttggttgttaatttatctgggcgtggtgat
aaagatatttttacagtacatgacattttaaaggaaaagggagagatttag

DBGET integrated database retrieval system