KEGG   Francisella sp. TX077308: F7308_1923Help
Entry
F7308_1923        CDS       T01560                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
frt  Francisella sp. TX077308
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F7308_1923
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F7308_1923
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F7308_1923
Enzymes [BR:frt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     F7308_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1976759..1977568
Genome map
AA seq 269 aa AA seqDB search
MDRYTTLFASLEKKNEGAFIPFVTLGDPNKELSLEIIDTLVSSGADALELGIPFSDPLAD
GPTIQEANIRALESGVTPRDCFDILTKIRVKHSHIPIGLLLYANLVYANGIENFYQKCLA
AGVDSILIADVPAHESKEFRDIAKKVGISQIFIAPPDASETTLKQISELGSGYTYLLSRV
GVTGAETAANMPVEDVLSKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKI
IQTNLSNKEKMFSELECFVKEMKAATKNN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatacacaaccctttttgcaagtttagagaaaaaaaatgaaggtgcttttata
ccttttgtaacacttggtgaccctaataaagaattatctcttgagattattgacactcta
gttagctcaggtgctgatgctcttgaactaggcatacctttttcagatccattagcagat
ggaccaacaattcaagaagcaaatattcgtgctctagagagtggcgtaactcctagagat
tgttttgatatactcacaaaaataagagtaaaacactctcatatccccattggcttattg
ctttatgcaaatttagtctatgcaaatggtatagagaatttttatcaaaaatgtttagct
gctggggttgattctatacttatagctgatgtgccagcccatgaatctaaagagtttcgt
gatattgctaaaaaagtaggtatctctcagatatttattgctccacctgatgctagtgag
actactcttaaacaaatttctgaacttggaagtggttatacgtatttactatcgagagtt
ggtgtaacaggtgcggaaactgcagcaaatatgccagtggaagatgtactgtctaaactt
agagaatataatgcgcctaagccagttttaggctttggtatctctaaacctgagcaggta
caacaagctatcaaagcaggtgctgctggtgcaatttcaggttctgcaacagtaaaaata
attcaaaccaatctctcaaataaagaaaaaatgtttagcgagcttgaatgtttcgttaaa
gaaatgaaagccgcaactaaaaataattaa

DBGET integrated database retrieval system