KEGG   Francisella sp. TX077308: F7308_1970Help
Entry
F7308_1970        CDS       T01560                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
frt  Francisella sp. TX077308
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F7308_1970
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F7308_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2022574..2023515)
Genome map
AA seq 313 aa AA seqDB search
MKNIEINMSVVVVGSANRDLVVKVDQLAQKGQTIISQNYEEFCGGKGANQAVAARRLGEN
VTFITNLGKDSFGDRLLEFYKKEGLDSLTINQDSGSNTGLAFICVDNQGQNIINVVMGAN
AKLDQQILDKHNQKIQQAKIILTQLETPLETIEYLANKITDKQTFILNPAPARELPQELL
KKVDILTPNETEASILSGIEVKDVNTAKQAAKELHNKGVSTVIVTLGEQGALLSKNNGQE
QKLFATKKVDVVDTTAAGDTFNGVLAFCLDKGLSIEQSIEIANTAAALAVTIEGAEDSAP
TLEKLNTYLEQKI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagaaatcaatatgtcagtagttgttgtaggaagtgccaatagagattta
gttgtaaaagttgatcaacttgcacaaaaaggtcaaacgataataagtcaaaattatgaa
gagttttgtggtggtaaaggagctaatcaagctgtagctgcaagaagacttggcgaaaat
gtaacttttattacaaaccttggtaaagatagttttggagataggcttttagagttttat
aaaaaagaaggtctagatagcttaactatcaatcaagattctggtagtaatacaggtttg
gcttttatttgtgttgataatcaaggtcaaaatataattaatgtagtaatgggagctaat
gctaagttagatcagcaaattttggacaaacataaccaaaaaatccaacaagcaaaaatc
atattaacccaactagaaactcctttggaaactattgagtatttagcaaataaaatcact
gataaacaaacttttatattaaaccctgccccagctagagagctacctcaagagctactc
aaaaaggtagatatattaacgccaaatgagactgaggcatctattttgtcaggtatagag
gttaaagacgtaaatacagctaagcaggcagcaaaagagctgcataataaaggtgtatct
acagttatagtaactttgggtgaacaaggcgctttattatcaaaaaataatggtcaagaa
caaaaattatttgctaccaaaaaagtagatgtggtagacactacagctgcaggagatact
tttaatggtgttttggcattttgtctagacaaaggattatctatagaacaatcaatcgag
atagctaatacagcagcagctctagcagtaactatagagggggcagaagattcagcacct
actttagagaaattgaatacttatttagaacaaaaaatataa

DBGET integrated database retrieval system