KEGG   Fibrobacter succinogenes: FSU_0029Help
Entry
FSU_0029          CDS       T02105                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fsc  Fibrobacter succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FSU_0029 (folP)
Enzymes [BR:fsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FSU_0029 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32073..32987)
Genome map
AA seq 304 aa AA seqDB search
MLRSLLESNRAISWKIGNDIIPASRMPLVMGIVNVTPDSFFDGGKHNTPEAAYEHAISLV
EQGAVILDIGGESSRPGSAPVSLQEELDRVCPVVEALAQTATISEDLDNPGFRKFYISVD
TVKAKVAEECMKLGAHIINDISACMMDPKMIETVASTKASVVLNHMRGNFGTMQQDFKPY
TNVVQEVQEELLAQVKKLLDAGVEKERICIDPGIGFGKTVQDNIDLMKSVDVMLKDGYPV
LIGTSRKSYIGKMPGLETSDRLIPTVTADIIAALGGASVIRVHDVREAKESLLYLEALKS
HDAV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctctctattagaatctaatcgtgcaatctcttggaaaattggaaacgacatc
attccagcttcgaggatgccgcttgtcatgggtatcgtgaatgttaccccggacagtttc
tttgatggaggcaagcataacacgcccgaagccgcttacgagcacgctatttcgttggtg
gaacaaggtgctgtgattctcgatatcggcggagaaagcagccgtccgggaagcgctccc
gtgagccttcaagaagaactcgaccgcgtatgccccgtcgtagaagcactcgcacagaca
gcaaccatttcggaagacctagacaatccgggattccgcaagttctacatctcggtcgat
acggtcaaggctaaagtcgccgaagaatgcatgaagctcggtgcgcacatcatcaacgac
atcagcgcctgcatgatggacccgaagatgatcgagaccgttgcaagcacaaaggcaagc
gtggtgctgaaccacatgcgcgggaacttcggaacgatgcagcaggacttcaagccgtac
acaaacgtggtgcaggaagttcaggaagaactcttggctcaggtgaagaagctccttgac
gccggtgtcgaaaaagaacgcatttgcattgatccgggtatcggttttgggaaaacggtt
caagacaacatagacttgatgaagtccgtggacgtgatgctcaaggacggctaccccgtt
ttgatcggcacgtcgagaaagtcctacatcggaaagatgcctggacttgaaacaagcgat
agacttatcccgaccgtgaccgcagacattatcgctgcccttggcggtgcaagcgttatc
cgcgttcacgatgttcgcgaagcaaaagaatcacttttatatttggaggctttgaagtcc
catgacgctgtttaa

DBGET integrated database retrieval system