KEGG   Fibrobacter succinogenes: FSU_0296Help
Entry
FSU_0296          CDS       T02105                                 

Definition
AMP-binding family protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FSU_0296
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FSU_0296
   00620 Pyruvate metabolism
    FSU_0296
   00640 Propanoate metabolism
    FSU_0296
  Energy metabolism
   00680 Methane metabolism
    FSU_0296
Enzymes [BR:fsc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FSU_0296
Lipid biosynthesis proteins [BR:fsc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FSU_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332685..334412
Genome map
AA seq 575 aa AA seqDB search
MILNKFLSKIDYKSYEDLYKNFKITIPNDFNFAYDVVDEYAKTEPKREALVWCDDNDESH
IYTFKDLSLASQRTANFLVEQGIQKGDRVMLILRRRYEFWFFLLALHRIGAIAIPATNML
AAEDLEYRFNAAEIKMVVTYDDPALQKEVDKAKSKCESVEKLVTVGQTARQNWISFYDDY
ELFPSTFERPVGDAATHNDDIMIVYFTSGTSSNPKMVAHTYTYPLGHIVTAKYWQHVVDG
GRHLTVAETGWAKALWGKIYGQWIAGSAVFTYDMTTFIPGKLLEKMAEYKVTTFCAPPTV
YRYILQHGLSKYDLSSLQYCTTAGEALNLDIYNRFYEQTGIRMQEGYGQTELTLTTGNFG
FSEPHPGSIGKPSPGYQMEIINAEGKPCEAEEVGELIIKIDQGKPFGMFGGYYRNAERTE
KVFEGGVYHTGDTAYRDKDGFFWFVGRTDDLIKSSGYRINPFEVEEVLHKHPAVLEVAVT
GVEDKSRGQAVKATVVLQKGYEASKELAKEIQLFAKNIAASYKSPRIIDFVTELPKTISG
KIRRATIRDKDTAENVTAPDEANAENAASETSEEK
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaataagtttctatctaaaattgattacaagtcttatgaagacttgtataaa
aatttcaagataacgattccgaacgattttaacttcgcttatgacgttgttgacgaatat
gccaagacggagccgaagcgtgaagccctcgtgtggtgtgacgacaacgacgaaagccac
atttacacgttcaaggacttgtcgctagcctcccagcgcacggcgaatttccttgtagaa
caaggtatccagaagggcgaccgcgtgatgctcatcttgcgccgccgctacgaattctgg
tttttcttgctcgctctgcaccgcattggcgcaatcgccatcccggcaacaaacatgctc
gccgccgaggatttggaataccgattcaacgccgccgaaatcaagatggtcgtaacatac
gacgatcccgccttgcaaaaggaagtggacaaggcaaagtccaagtgcgaatcggtcgaa
aagctcgtgacagtcggccagactgctcgccagaactggattagcttctacgacgactac
gaacttttcccctcaacgtttgaacgccccgttggcgatgccgctacgcataacgacgac
atcatgatcgtctatttcacgagtggcacgagctcaaatccgaagatggtggcacacact
tatacgtacccgctcggacacattgtaaccgccaagtactggcagcacgttgtggacgga
ggtcgccatttgaccgttgccgaaacaggctgggccaaggctctctggggcaaaatttac
gggcagtggattgctggaagcgccgtgttcacttacgacatgaccacgttcatcccgggc
aagctcctcgagaagatggcggaatacaaggtgacgacgttctgcgcgccgccgaccgtg
taccgctacattttgcagcatggcctcagcaagtacgacctttcgagtttgcagtactgc
acaaccgctggcgaagcgttgaacttggatatttacaacaggttttatgagcagacgggc
atccgcatgcaggaaggctacggacagaccgagcttacacttaccacgggtaactttggc
tttagcgaaccgcatccgggttctatcggcaaaccctctccaggctaccagatggaaatc
atcaatgccgaaggcaagccgtgcgaggctgaagaagtcggtgagcttatcatcaagatt
gaccagggcaagccttttggcatgttcggcggttactatcgcaatgcagaacgcaccgag
aaagtctttgaaggcggagtgtatcacaccggcgatacggcttaccgcgacaaggacgga
ttcttctggttcgtgggccgcacggatgacttgatcaagagctccggttaccgcatcaac
cccttcgaagtggaagaagtgttgcacaagcaccctgccgttttggaagtcgctgtaaca
ggtgtcgaagacaagtctcgcggtcaagcggtcaaggcaacagtcgttttgcagaagggc
tacgaagcctccaaggaacttgcgaaggaaatccagctctttgcaaagaacattgccgca
agttacaagagccctcgcatcattgactttgtgacggaactgccaaagacaatcagcgga
aagattcgacgcgcaaccatccgcgacaaggatacggctgagaatgtgactgcgccggac
gaagcgaatgcggaaaacgccgcaagcgaaacgtctgaagaaaagtaa

DBGET integrated database retrieval system