KEGG   Fibrobacter succinogenes: FSU_0299Help
Entry
FSU_0299          CDS       T02105                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fsc  Fibrobacter succinogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FSU_0299 (hemB)
Enzymes [BR:fsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FSU_0299 (hemB)
Exosome [BR:fsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FSU_0299 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(336678..337643)
Genome map
AA seq 321 aa AA seqDB search
MIIRPRRLRRNEVIRNMVAETAVNPDALVYPMFVVEGTGVKEEIPSMPNQFRFSIDEILK
ELESCVALGIKSILLFGIPNHKDEMATSAYDKNGIVQRAVRAIKAKFPSLYVITDVCLCE
YMSHGHCGIIKDGDVDNDPTLELLAKTAVSQVAAGADMVAPSDMMDGHITALREALDNAG
FTNTPIMGYSAKFASAYYGPFRDAADSAPHFGNRKSYQMDVRNGREALHEVELDLEECAD
IVMVKPGLAFLDVLRQTAEISNVPVAVYNVSGEYSMVKAAAKMGWIDEKSIIRENMIAFK
RAGADIIITYHAKEILENKIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattattcgtcctcgtcgtttacgtagaaatgaagttatccgcaacatggttgcagaa
actgctgtaaatcccgatgccctcgtttacccgatgttcgtggttgaaggaacgggcgtc
aaagaagaaatcccgtccatgccgaaccagttccgtttctcgattgatgaaatcttgaag
gaacttgaaagctgtgtcgcgcttggcatcaagtccattttgctattcggcatcccgaat
cacaaggacgagatggcgacttcggcttatgataaaaacggcattgtgcagcgtgctgtg
cgtgctatcaaggcgaagttcccgagtttgtacgtgattacggacgtgtgcctttgcgaa
tacatgagccatggccattgcggcattatcaaggatggtgatgtggataatgacccaacg
cttgaacttttggcaaagaccgctgtttcgcaggtggctgccggtgccgacatggtggct
ccgagtgacatgatggatggccacatcacggctctccgcgaagctcttgacaatgcgggc
tttacaaatacgccgattatgggttatagcgcaaagttcgctagcgcttattacggtccg
ttccgcgatgccgctgattccgctccgcatttcggcaaccgcaagagttaccagatggac
gtgcgcaatggtcgcgaagcgctccatgaagtggaactcgatcttgaagaatgtgcagat
atcgtgatggtaaagcctggcctcgcattcctcgatgtgcttcgccagacggctgaaatc
agcaatgtgccggtcgctgtgtataacgtaagtggtgaatattcgatggtcaaggctgct
gcaaaaatgggctggattgatgaaaagtcgattatccgcgaaaacatgattgcgttcaag
cgcgccggtgctgatatcatcattacgtaccacgccaaggaaattttggaaaataaaatt
ctgtaa

DBGET integrated database retrieval system