KEGG   Fibrobacter succinogenes: FSU_0310Help
Entry
FSU_0310          CDS       T02105                                 

Definition
pyridoxal-phosphate dependent TrpB family enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FSU_0310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSU_0310
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FSU_0310
Enzymes [BR:fsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FSU_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349736..351121
Genome map
AA seq 461 aa AA seqDB search
MRNSLKIDGQVKTYLHEDELPKAWYNVRADMKKKPAPLLNPGTGKPVTFEDLQPVFCDEL
IKQELDNDTAYIEIPEDIRTFYKMYRPSPLVRAYFLEQALGTPAHIYYKFEGNNTSGSHK
LNSAIAQAYYAKKQGLKGVTTETGAGQWGTALSMSSAFFGLDCQVYMVKVSYEQKPFRRE
VMRTYGASVTPSPSMTTDIGRKINAEFPGTTGSLGCAISEAVEAAVKQPGYRYVLGSVLN
QVLLHQSVIGLETKAALDKIGVKADLIIGCAGGGSNLGGLVSPFIGEKLRGEADYDILAV
EPASCPSFTRGKYAYDFCDTGKVCPLAKMYTLGSSFIPSANHAGGLRYHGMSSILSELYD
QGLMRATSVEQTKVFEAAKLFAQTEGILPAPESSHAIRATIDEALKCKESGQAKNIVFGL
TGTGYFDMVAYQKFNDGEMSDYIPTDEDIAKSLAQLPKVEG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactcgctcaagatcgatggtcaggtcaagacttatctccacgaagatgaactt
ccgaaggcatggtacaacgtccgcgccgacatgaagaagaagcccgctccgcttctgaac
ccgggaaccggcaagccggtgactttcgaagacctgcagccggttttctgcgatgaactc
atcaagcaggaacttgataacgataccgcttacatcgaaattccggaagacatccgcacg
ttctacaagatgtaccgtccgtctccgctcgttcgcgcttacttcctcgaacaggctctc
ggcactccggctcacatctactacaagttcgaaggcaacaacacctcgggttctcacaag
ctcaactccgccatcgctcaggcctactacgctaagaagcagggcctcaagggcgtgacg
accgaaacgggtgcaggccagtggggtaccgccctttcgatgtccagtgccttcttcgga
ctggactgccaggtttacatggtgaaggtttcttatgaacagaagccgttccgccgcgaa
gtgatgcgcacctacggtgcatccgtcaccccgtccccgtccatgacgaccgacatcggc
cgcaagatcaacgccgaattcccgggcaccacgggtagccttggctgcgctatttccgaa
gctgtggaagccgctgtgaagcagccgggttaccgctatgttctcggttccgtgctaaac
caggtgctcctccaccagtccgtcatcggtctcgaaacgaaggctgcactcgacaagatc
ggcgtgaaggccgacctcatcatcggttgcgctggcggtggttctaacctcggtggtctc
gtgagcccgttcatcggcgaaaagctccgtggcgaagccgactacgatattctcgctgtg
gaaccggcaagctgcccgagcttcactcgcggtaagtacgcttacgacttctgcgacacc
ggtaaggtctgcccgctcgccaagatgtacacgctcggttctagcttcatcccgtctgca
aaccacgctggtggcctccgctaccacggcatgagcagcattctctctgaactttacgat
cagggactcatgcgtgcaacgtctgtcgaacaaactaaggtcttcgaagccgcaaagctt
ttcgcccagaccgaaggtatcctcccggctccggaatccagccacgccatccgcgcaacg
atcgacgaagctctcaagtgcaaggaaagcggtcaggccaagaacatcgtattcggtctc
accggcacgggttacttcgacatggttgcttaccagaagttcaacgacggcgaaatgagc
gactacatcccgacggatgaagacattgccaagagcctcgcccagcttccgaaggtcgaa
ggctaa

DBGET integrated database retrieval system