KEGG   Fibrobacter succinogenes: FSU_0369Help
Entry
FSU_0369          CDS       T02105                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fsc  Fibrobacter succinogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FSU_0369
Enzymes [BR:fsc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FSU_0369
Exosome [BR:fsc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FSU_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
420264..422492
Genome map
AA seq 742 aa AA seqDB search
MRKSMEWNDFTSLTAENMQAIWDFKTKDPFSILGIHPLETDRGIKTVIRTYQPQASFVRG
ESCDGTEEFDFVKLGDTGFFEAILDLEYKPFFYKLIIKQGDGIEYTLVDPYAFLPVLSDF
DRHLIATGTHYELYRKLGANIIEHQGFKGVHFAVWAPNARAVSVVGNFNSWDGRRHQMRM
LGASGIWEIFIPNLGENELYRFEIHGADGNLHVKVDPLAKLAEVRPATASITTHLDGYEW
GDDLYMKTHWATKVFGAPMNIYEVHAGSWRRDPANPDRFLNWDELSERLIPYLKEMGYTH
VEFLPLAEHPLDESWGYQVTGYYSPTSRYGTPDQFRHFVDLCHQNEIGVILDWVPAHFPK
DAHALGRFDGTACYEHADPRQGEHPHWGTYIFNLGRNEVKNFLIANAMYWLKEFHCDGLR
VDAVASMLYLDYGKGPGEWVPNKDGGNINYDTLEFLKHLNSIMGRLTPHAILIAEESTSF
PSITRPPEQGGLGFHYKWNMGWMNDFLSYIQHEPIHRKYHHNQLTFSMVYAYSENFIQVF
SHDEVVHGKGSMLGKMPGDNWQKFANLRLTYAFQYAHPGKKLNFMGNEFGQFREWNEKRS
LDWHLVSWDSHGKLLEMMKVLNHIYKENAPLWEIDHYYTGFEWIWCDDADNSIVSFVRKD
DHGNMILCVFNFTPVVRNDYRLGAPARGAWKEIFNTDAAMFGGSNVGNLGEVWTQDVPWQ
NREWSLNIKLPPLAAVYFKLER
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaatctatggaatggaacgatttcacgagcctgaccgcagaaaacatgcaggca
atttgggacttcaagactaaagacccgttttcaattttaggtatccacccgctcgaaacc
gatcgcgggatcaagaccgtcatccgcacctaccagccgcaggccagctttgtccgcggt
gaatcgtgcgacggcactgaagaatttgattttgtgaagcttggcgacacaggatttttc
gaagccatcctcgacttggaatacaagccgttcttttacaagctcatcatcaagcagggc
gacggcatcgaatacacgctcgtcgatccgtatgcattcttgccggtcctcagcgacttt
gaccgccacctgattgcaacaggcacgcactacgaactttaccgcaagctcggcgccaac
atcatcgaacaccagggattcaagggcgttcacttcgccgtctgggctccgaacgctcgt
gccgtttctgtggtcggcaacttcaacagctgggacggccgccgtcaccagatgcgcatg
ctcggtgcctcgggcatttgggaaatcttcattccgaatcttggtgaaaacgaactctac
cgctttgaaattcacggcgccgacgggaacctccatgtgaaggtggacccgcttgcaaag
ctcgccgaagtccgcccggcaacagcctccatcacaacacacctcgacggttacgaatgg
ggcgatgatctttacatgaagacgcactgggccacaaaggtctttggcgctccgatgaac
atttacgaagtccacgccggttcctggcgtcgcgacccggctaatccggaccgtttcctc
aactgggacgagctctccgaacgcctcatcccgtacctcaaggaaatgggatacacgcac
gtggaattcttgccgctcgccgaacacccgctcgacgaatcttggggctaccaggttacc
ggttactactcccccacgagccgctacggcacaccggaccaattccgccactttgtggac
ctttgccaccagaacgaaatcggcgtgattttggactgggttccggcccacttcccgaag
gatgcacacgctctcggacgtttcgacggcactgcctgctacgagcatgccgacccgcgt
cagggcgaacacccgcactggggcacatacatctttaacctcggccgtaacgaagtcaag
aacttcctcattgcaaacgcgatgtactggctcaaggaattccactgcgacggtctccgc
gtcgatgctgtagcctccatgctttacctcgactacggtaagggtccgggcgaatgggtg
ccaaacaaggacggcggcaacatcaactacgatacgctcgaattcctgaagcacttgaac
agcatcatgggtcgcctgaccccgcatgccatcctcatcgccgaagaatcaacaagcttc
ccgagcatcactcgcccgccagagcagggcggtctcggcttccactacaagtggaacatg
ggctggatgaacgacttcttgagctacatccagcacgaaccgatccaccgcaagtaccac
cataaccagcttacgttcagcatggtctacgcttattctgaaaacttcatacaagttttc
agccatgacgaagtggtacacggcaagggttccatgctcggcaagatgcctggcgacaac
tggcagaagtttgcaaacctccgcctcacctacgctttccagtacgcacacccgggcaag
aagctcaacttcatgggcaacgaattcggtcagttccgcgaatggaacgaaaagcgctcg
cttgactggcacttggtcagctgggatagccacggcaagctccttgaaatgatgaaggtt
ctgaaccacatctacaaggaaaatgctccgctatgggaaattgaccattactacaccggc
tttgaatggatctggtgcgacgacgccgacaattccatcgtaagcttcgtccgcaaggat
gaccatggcaacatgattctctgcgtgttcaacttcacgccggttgtccgtaacgattac
cgtctgggcgctcctgctcgcggtgcttggaaagaaattttcaacaccgatgcagccatg
ttcggcggctccaacgtcggcaatctcggtgaagtctggacgcaagatgttccatggcag
aatcgtgaatggagcttgaacatcaagcttccgcctctcgcggcagtttacttcaaactc
gagagatag

DBGET integrated database retrieval system