KEGG   Fibrobacter succinogenes: FSU_0580Help
Entry
FSU_0580          CDS       T02105                                 

Gene name
trpCF
Definition
indole-3-glycerol phosphate synthase/N-(5'-phosphoribosyl)anthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fsc  Fibrobacter succinogenes
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fsc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fsc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
648060..649619
Genome map
AA seq 519 aa AA seqDB search
MSEDILQKIVRMRREDIDRLGLNFNIDIPEARRVGHTEFLGNAGAILEVKRASPSKGDIA
PNLNPVELATTYAEAHAQAVSVLTEMNFFKGSLRDLIAVADLMERRRQQGLHTCAVLRKD
FLLFEDEIDIAYRCGADAVLLIARILDDAQLVKMAQRAQKFGIQAFVEVREADDFRKLAV
VTAALGDAAAKTIVAGVNSRDLATFHTDPLIPASVRSKLPAKAVFESGILSAADATYARN
LGFTGILVGEAVAKNPPLAKDVVSAFESGCENARGLFWKKFAERKFANNETRAASSQDAR
RPLVKICGITREEDGLLAAELGADMLGFVFSTTKRLTTEEFVRSFKTRLLRSACNDVAPL
LVGVITDPNSVEGKTAIKLAQEGVLDAVQFHGVNPHNSDALAESCSAALPYYCAARVGAP
EDFDYIASLRKNGEPRILLDAKVEGIPGGTGKTIPESLLREKANGAPLWLAGGITPENVA
TICEKFHPELIDISSGIEDAPGIKNHDKMKALFAEFAAK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagatattttgcaaaaaatcgtgcggatgcgccgcgaagacatcgatagactt
ggactgaatttcaacattgatattcccgaggcgcgtcgcgttggtcatactgaatttttg
ggtaatgcaggagccatccttgaggtcaagagggcttcgccatccaagggagacatcgcg
ccgaacttgaatccggtggaactcgccacgacttacgccgaagcacacgctcaagccgtt
tccgtgctgaccgaaatgaactttttcaagggttcgctccgcgacctgattgccgttgca
gacttgatggaacgccgccgtcagcagggcttgcacacttgcgctgttctccgcaaagat
ttccttttattcgaagacgaaattgacattgcataccgctgtggcgccgatgccgtatta
ctcatcgcccgcatcctcgacgacgcccaactcgtaaagatggctcagcgcgcgcagaag
ttcggcattcaggcattcgttgaagtccgcgaagctgacgatttccgcaagcttgccgtt
gtgacagccgctctcggtgatgcagccgccaagacgattgtcgcaggcgtcaattcccgc
gatctcgccacattccacacggacccgctgattcccgcaagcgtccgcagcaagctcccc
gccaaagccgtttttgaatcgggcattctgagcgccgccgatgcgacatacgcccgcaat
ctcggattcacgggcattctcgtcggagaagccgtagccaagaatcccccgctcgccaaa
gacgttgtgagcgcattcgaaagcggatgcgaaaacgcccgcggtctgttctggaagaaa
ttcgccgaacgcaagtttgccaataacgagactcgcgcagcctcatcacaagatgcgcgc
cgcccgctcgtgaaaatctgcggcatcacccgcgaagaagacggtctcctcgccgccgaa
ctcggcgccgacatgctcggattcgtgttcagcaccaccaagagactcaccaccgaagaa
ttcgtgcgcagtttcaagactagattgcttcgctccgcttgcaatgacgtagctccgctt
ctcgttggcgtgattaccgacccgaattccgtcgaaggcaaaaccgccatcaagctcgcc
caagaaggcgtgctcgacgccgtacagttccacggcgttaatccgcacaattccgacgca
ctcgcggaatcttgcagcgcagccctcccctactactgcgcagcacgcgtaggcgccccc
gaagacttcgattacatcgcaagtctccgcaagaacggcgagccccgcattttgctggac
gccaaggtcgaaggcatccccggcggcaccggcaagaccatccccgaatcgctcctccgc
gaaaaagcaaacggagccccgctttggctcgccggcggcatcacccctgaaaacgtcgcc
accatctgcgaaaagttccaccccgaactcattgacatatctagcggcatcgaagacgcc
cccggcatcaagaatcacgacaagatgaaagcgctgtttgcggaattcgccgcaaaataa

DBGET integrated database retrieval system