KEGG   Fibrobacter succinogenes: FSU_0587Help
Entry
FSU_0587          CDS       T02105                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsc  Fibrobacter succinogenes
Pathway
fsc00260  Glycine, serine and threonine metabolism
fsc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fsc01100  Metabolic pathways
fsc01110  Biosynthesis of secondary metabolites
fsc01130  Biosynthesis of antibiotics
fsc01230  Biosynthesis of amino acids
Module
fsc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSU_0587 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FSU_0587 (trpA)
Enzymes [BR:fsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FSU_0587 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ADL26377
UniProt: C9RJT1
Position
654001..654753
Genome map
AA seq 250 aa AA seqDB search
MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADGPAIQTASTIALEKGY
STKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKDAGVSACIIPDLPFDHD
EGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALRAGTTGSETTIDQATLDF
IDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNIVLANADTAEGRAKAIAAI
EAKAKEIAGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatgtctcatcttattgcgggttttcctgacgctgaaacttctatcgccatc
gccgacgcacttgtgaagggtggcgccaacatccttgaaatccagctcgcgttcagtgac
ccgagcgcagacggtccagccatccagacagcctccaccatcgctctcgaaaaaggctat
tccaccaagcagggccttgccatcgtgaagcagattcacgaacgccaccctgaaacgccg
atttacatcatgacttacggttccctcgcctttacgccgggcgtcgaaaactttgtcaag
atgtgcaaggacgcaggcgtttctgcttgcatcattccggaccttccgtttgaccatgac
gaaggcctcaccgaagcttgcaagaagcacggtctcgaaaacattccggttgccgctccg
agcatgaccaaggaacgtctcgaaacgatggcttctgcaggtttcaagtacatctacgcc
gcactccgcgcaggcacgaccggaagcgaaacaacgattgaccaggcaacgcttgacttt
atcgacacagtcggtaagcatggcgccaaggttctcggtggtttcggcatccgcaatggc
gaacagtccaaggtgctttcgaagcatgtgtacgctgtggtcgcaggttccgtcttcgtg
aacatcgtgctcgcaaacgcagacaccgccgaaggccgcgcaaaagccatcgccgctatc
gaagctaaggccaaggaaatcgccggaaagtaa

DBGET integrated database retrieval system