KEGG   Fibrobacter succinogenes: FSU_0587Help
Entry
FSU_0587          CDS       T02105                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FSU_0587 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSU_0587 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FSU_0587 (trpA)
Enzymes [BR:fsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FSU_0587 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
654001..654753
Genome map
AA seq 250 aa AA seqDB search
MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADGPAIQTASTIALEKGY
STKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKDAGVSACIIPDLPFDHD
EGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALRAGTTGSETTIDQATLDF
IDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNIVLANADTAEGRAKAIAAI
EAKAKEIAGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatgtctcatcttattgcgggttttcctgacgctgaaacttctatcgccatc
gccgacgcacttgtgaagggtggcgccaacatccttgaaatccagctcgcgttcagtgac
ccgagcgcagacggtccagccatccagacagcctccaccatcgctctcgaaaaaggctat
tccaccaagcagggccttgccatcgtgaagcagattcacgaacgccaccctgaaacgccg
atttacatcatgacttacggttccctcgcctttacgccgggcgtcgaaaactttgtcaag
atgtgcaaggacgcaggcgtttctgcttgcatcattccggaccttccgtttgaccatgac
gaaggcctcaccgaagcttgcaagaagcacggtctcgaaaacattccggttgccgctccg
agcatgaccaaggaacgtctcgaaacgatggcttctgcaggtttcaagtacatctacgcc
gcactccgcgcaggcacgaccggaagcgaaacaacgattgaccaggcaacgcttgacttt
atcgacacagtcggtaagcatggcgccaaggttctcggtggtttcggcatccgcaatggc
gaacagtccaaggtgctttcgaagcatgtgtacgctgtggtcgcaggttccgtcttcgtg
aacatcgtgctcgcaaacgcagacaccgccgaaggccgcgcaaaagccatcgccgctatc
gaagctaaggccaaggaaatcgccggaaagtaa

DBGET integrated database retrieval system