KEGG   Fibrobacter succinogenes: FSU_1158Help
Entry
FSU_1158          CDS       T02105                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FSU_1158 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSU_1158 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FSU_1158 (thrC)
Enzymes [BR:fsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FSU_1158 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1307099..1308439
Genome map
AA seq 446 aa AA seqDB search
MSQFNAHFRNINGDDTYPLTDVIYRSKVDGSLLEVEHDRAALASRSPEEWKKLFAERRMS
FKPEDMSGIWSKREMVLPDIPVEDIVTMREGWSPLFDAAPLAKELGIGSLKVKLCGNSHT
GSFKDLGMTVLVSQVNHIIKKGIHPIDAVACASTGDTSAALSAYCAKAGIPSIVFLPAGK
TSTAQLIQPISNGSIVLALDTDFDGCMKIVQEVTKDNRIYLANSMNSLRVEGQKTISPEI
CQELGWTVPDTVIIPGGNLGNVSALAKGFEDCKAMGLIDRIPRIIVAQAENANPFYQAYE
RGFDKLVPVQAKKTLASAIQIGNPVSYPKAVRAIQKTNGMVVSVSEEELANAAHRGDRIG
LYCCPHTGVALGALEKLVAAGKITKDENVVVISTAHGLKFTEFKVGYHEQKLENIASKYA
NPVFKAPAEIGAVMDILTKEMAARRR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtttaacgctcattttagaaacatcaacggcgacgatacctacccgctgacc
gacgtcatttaccgcagcaaggtggacggtagcttgctcgaagtcgaacacgaccgagca
gcactcgccagccgcagcccggaagaatggaagaagctctttgccgaacgccgcatgagc
tttaagcccgaagacatgagtggtatttggagcaagcgcgaaatggtgctcccggatatt
ccggtcgaagacatcgtcaccatgcgcgaaggctggagcccgctttttgacgcagccccg
ctcgccaaggaactcggcatcggaagcctcaaggtgaagctctgcggcaactcccacacg
ggttctttcaaggaccttggcatgaccgttctcgtgagccaggtgaatcacatcatcaag
aagggcatccacccgattgacgccgtcgcttgcgcttctaccggtgatacctctgcagcc
ctcagcgcctactgcgccaaggcaggcattccgtctatcgtgttcctcccggccggcaag
accagcactgcacagctcatccagccgatttctaacggcagcattgtgctcgctcttgac
accgactttgacggttgcatgaagatcgttcaggaagtcacgaaggacaaccgcatttac
ctcgccaactccatgaacagcctccgcgtcgaaggccagaagacgatttctccggaaatc
tgccaagaactcggctggaccgttccggacaccgtgattatcccgggcggtaacctcggt
aacgtgagcgcacttgccaagggcttcgaagactgcaaggccatgggcctcatcgaccgc
atcccgcgcatcatcgttgctcaggcagaaaacgccaatccgttctaccaggcatacgaa
cgtggctttgacaagctcgttccggttcaggccaagaagactctcgcatctgctatccag
atcggtaacccggtcagctacccgaaggcagtccgcgctatccagaagacaaacggcatg
gtcgtaagcgtctctgaagaagaactcgccaacgcagcccaccgcggcgaccgcatcggt
ctctactgctgcccgcacacgggtgtcgctctcggcgctctcgaaaagctcgtcgctgca
ggcaagattacgaaggacgaaaacgtcgtcgtcatcagcacggctcacggtctcaagttc
acggaattcaaggtcggataccacgaacagaagctcgaaaacatcgccagcaagtacgca
aacccggtgttcaaggctcctgccgaaatcggtgctgtcatggacatcctcacgaaggaa
atggcagcccgccgtcgctaa

DBGET integrated database retrieval system