KEGG   Fibrobacter succinogenes: FSU_1158Help
Entry
FSU_1158          CDS       T02105                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fsc  Fibrobacter succinogenes
Pathway
fsc00260  Glycine, serine and threonine metabolism
fsc00750  Vitamin B6 metabolism
fsc01100  Metabolic pathways
fsc01110  Biosynthesis of secondary metabolites
fsc01120  Microbial metabolism in diverse environments
fsc01230  Biosynthesis of amino acids
Module
fsc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSU_1158 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FSU_1158 (thrC)
Enzymes [BR:fsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FSU_1158 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADL26032
UniProt: C9RMV3
Position
1307099..1308439
Genome map
AA seq 446 aa AA seqDB search
MSQFNAHFRNINGDDTYPLTDVIYRSKVDGSLLEVEHDRAALASRSPEEWKKLFAERRMS
FKPEDMSGIWSKREMVLPDIPVEDIVTMREGWSPLFDAAPLAKELGIGSLKVKLCGNSHT
GSFKDLGMTVLVSQVNHIIKKGIHPIDAVACASTGDTSAALSAYCAKAGIPSIVFLPAGK
TSTAQLIQPISNGSIVLALDTDFDGCMKIVQEVTKDNRIYLANSMNSLRVEGQKTISPEI
CQELGWTVPDTVIIPGGNLGNVSALAKGFEDCKAMGLIDRIPRIIVAQAENANPFYQAYE
RGFDKLVPVQAKKTLASAIQIGNPVSYPKAVRAIQKTNGMVVSVSEEELANAAHRGDRIG
LYCCPHTGVALGALEKLVAAGKITKDENVVVISTAHGLKFTEFKVGYHEQKLENIASKYA
NPVFKAPAEIGAVMDILTKEMAARRR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtttaacgctcattttagaaacatcaacggcgacgatacctacccgctgacc
gacgtcatttaccgcagcaaggtggacggtagcttgctcgaagtcgaacacgaccgagca
gcactcgccagccgcagcccggaagaatggaagaagctctttgccgaacgccgcatgagc
tttaagcccgaagacatgagtggtatttggagcaagcgcgaaatggtgctcccggatatt
ccggtcgaagacatcgtcaccatgcgcgaaggctggagcccgctttttgacgcagccccg
ctcgccaaggaactcggcatcggaagcctcaaggtgaagctctgcggcaactcccacacg
ggttctttcaaggaccttggcatgaccgttctcgtgagccaggtgaatcacatcatcaag
aagggcatccacccgattgacgccgtcgcttgcgcttctaccggtgatacctctgcagcc
ctcagcgcctactgcgccaaggcaggcattccgtctatcgtgttcctcccggccggcaag
accagcactgcacagctcatccagccgatttctaacggcagcattgtgctcgctcttgac
accgactttgacggttgcatgaagatcgttcaggaagtcacgaaggacaaccgcatttac
ctcgccaactccatgaacagcctccgcgtcgaaggccagaagacgatttctccggaaatc
tgccaagaactcggctggaccgttccggacaccgtgattatcccgggcggtaacctcggt
aacgtgagcgcacttgccaagggcttcgaagactgcaaggccatgggcctcatcgaccgc
atcccgcgcatcatcgttgctcaggcagaaaacgccaatccgttctaccaggcatacgaa
cgtggctttgacaagctcgttccggttcaggccaagaagactctcgcatctgctatccag
atcggtaacccggtcagctacccgaaggcagtccgcgctatccagaagacaaacggcatg
gtcgtaagcgtctctgaagaagaactcgccaacgcagcccaccgcggcgaccgcatcggt
ctctactgctgcccgcacacgggtgtcgctctcggcgctctcgaaaagctcgtcgctgca
ggcaagattacgaaggacgaaaacgtcgtcgtcatcagcacggctcacggtctcaagttc
acggaattcaaggtcggataccacgaacagaagctcgaaaacatcgccagcaagtacgca
aacccggtgttcaaggctcctgccgaaatcggtgctgtcatggacatcctcacgaaggaa
atggcagcccgccgtcgctaa

DBGET integrated database retrieval system