KEGG   Fibrobacter succinogenes: FSU_1195Help
Entry
FSU_1195          CDS       T02105                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fsc  Fibrobacter succinogenes
Brite
Enzymes [BR:fsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     FSU_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1353533..1354936
Genome map
AA seq 467 aa AA seqDB search
MKKHRISKFILSAAFLGAGFMNAQAADETIRELAKERGRFIGTILNSEWFNDAIEPEFEE
IHKTQFNVVVAENEMKFDATEPKEDEFNFEKGDKMVKYAQANGLRVRGHALAWHSQVANW
VNDYKGQKEKLLAVLKNHITKVVGHWKGKIAEWDVVNEAVNDDYNADWRSTNSVWYEGIG
AEFLDSAFVWAHEADPDAELCYNDYSIEWGLREGSKASFVVEQIKRWKANNIPITCVGTQ
THIEIAHETTPQNVRALAKALAELGVTLNITELDIGFSKGSAGKLTEADYAKQGHLYRQF
MDVFLEEPNMGEFVIWGLTDAHSWLDEQQGKTEGLLYDKQYNPKPAYDSVMASLKAHPAS
EVKTPYPESVLNPPKDCGTGNCDDPIAIKTLAKLNNISIHLAGRTLFVTGLALKTATKVD
IFDMQGHLVFSAKNVKGNIELSSTPEGLYVIQIRQGVTRLTKRITIK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacatcgtatttcaaaatttatactcagtgcagcatttcttggcgcaggcttc
atgaacgcacaagccgctgacgaaaccattcgtgagctcgccaaggaacgtggccgcttt
atcggcaccatcttgaatagcgaatggttcaacgacgcaattgaaccggaattcgaagaa
attcacaagactcaattcaacgtggtcgtcgccgaaaacgaaatgaagttcgacgccacc
gagcccaaagaagacgaattcaacttcgaaaagggcgacaagatggtcaaatacgcacag
gcaaacggactccgcgttcgtggacacgctctcgcctggcacagccaagttgcaaactgg
gtgaacgactataagggccaaaaagaaaagttgctcgccgttctcaagaaccacatcacc
aaagttgtcggccactggaaaggcaaaatcgccgaatgggatgtggtgaacgaagccgtc
aatgacgattacaatgccgactggcgttcgactaactccgtttggtacgaaggcatcggc
gcagaatttttggattccgcatttgtctgggcgcacgaagccgacccggatgcagaactc
tgctacaacgattattccatcgaatggggcctccgcgaaggatccaaggcaagctttgtc
gtggaacagatcaagcgctggaaagcaaacaacattcctatcacctgcgtaggcacacaa
acccacatcgaaattgcacacgaaacaactccgcaaaacgtgcgcgcactcgccaaagca
cttgcagaactcggcgtgacattgaacattaccgaacttgatatcggattctcgaagggt
tcagcaggcaagctcaccgaagcggactacgccaaacaaggacacttgtaccgccaattc
atggatgtgttcctcgaagaaccgaacatgggcgaattcgtgatttggggattgaccgat
gctcacagctggctagacgaacagcaagggaagaccgaaggacttctttacgacaagcaa
tacaacccgaagcccgcatacgatagcgtcatggcaagtctcaaggcgcaccccgcttcc
gaagtcaaaactccatacccagaatccgttctcaacccgcccaaagattgcgggaccggc
aactgcgacgatcccatcgccatcaagacgctcgccaagttgaacaacatatctatacac
ctcgccggacgcacactgttcgtaacaggtttggctttgaagacggcaacaaaggttgac
atattcgacatgcaaggtcaccttgtattcagcgcaaagaacgtcaaaggcaacattgag
ctttcttcaactcctgaaggattatacgttattcaaatccgtcagggcgtaacaagactt
accaaacgaatcaccattaagtaa

DBGET integrated database retrieval system