KEGG   Fibrobacter succinogenes: FSU_1218Help
Entry
FSU_1218          CDS       T02105                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fsc  Fibrobacter succinogenes
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:fsc00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:fsc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1390798..1391361)
Genome map
AA seq 187 aa AA seqDB search
MSKFNFINTEIEGVKIIEPTVFGDARGYFMETYSKRDFAEGGIDVDFVQDNESRSRKGVL
RGLHFQKQNPQGKLVRVIEGEVFDVAVDLRKNSKTFGKWVGVTLSAENKKQFYIPEGFAH
GFVVLSETAAFVYKCTRFYAPNDEGGLFWNDPAIGIKWPVGEGFEPLLSEKDTKNPLLKD
LDFAFDL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattcaactttataaatacagaaatcgaaggtgttaagattattgaaccgacg
gtgtttggtgacgctcgcggttactttatggaaacttacagcaagcgcgactttgccgaa
ggcggcattgacgtagactttgttcaagataacgagtcccgttcgcgcaagggcgttctc
cgcggtctccacttccagaagcagaatccgcagggcaagcttgtccgcgtgattgaaggc
gaagtctttgacgtggccgtggacctccgcaagaacagcaagacttttggcaagtgggtg
ggtgttacgctctccgccgaaaacaagaaacagttctacatcccagaaggctttgcacac
ggtttcgtggtactttccgaaacggctgcatttgtctacaaatgcactcgcttctacgct
ccgaatgatgaaggcggccttttctggaacgacccggctatcggcatcaagtggccggtg
ggcgaaggttttgaaccgctcctctctgaaaaggataccaagaatcctcttctcaaggac
cttgatttcgcttttgacctttag

DBGET integrated database retrieval system