KEGG   Fibrobacter succinogenes: FSU_1304Help
Entry
FSU_1304          CDS       T02105                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fsc  Fibrobacter succinogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FSU_1304
Enzymes [BR:fsc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FSU_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1512739..1514712)
Genome map
AA seq 657 aa AA seqDB search
MRYGDLTSFQTGVAVPLFSLHSKHSIGIGEFLDLIPFAQWAKFCGFNIIQLLPVNDTGSE
PSPYSARSAFALNPVFINVQSVEGATVLEHEIEKARAQFAGIERVDYYRITTWKRAILRK
IFDNQYDVLKSSKKLLAWIDKNSWVKSYCVYCTLKAQNNEASWKDWKKFQNPSAADVDKL
WMKNYRDVLFQAWMQYTAEGQFTAAVNEVSKLGLRLKGDVPILINEDSADVWFDRKYFSL
ADRAGAPPDMFSYGGQNWGFPTYRWDVLEADDFGWWRRRLAQASKFYHAYRIDHVLGFFR
IWAIPESESTGILGRFQPSIPLTWDVLRNAGFYRETLEYLRRPNFSVDQLREFLGSETDR
LISLYFENLPGKFDRFVIKPEYLSERAILSLDEPQEVKDSMLRVYWNRVFIPTGDENTFY
PYWYWYNQPVLFTLPQNEQDKLHDLIGQNEQAQNALWEQNAMKLLSVLANETDMLVCAED
LGAVPPCVPTVLKKLDIMSLRIERWARNWNVPYSPYYSMDEYPRLSVCTTSCHDTSTLRG
MWEEPDFDKGFYWSHAGLPGVAPEKLTPPVVHDILSHVFTANSLFCIPPIQDYFALSASL
SDCDPKEERVNIPGTVGGKNWTYRTPCSVEDLLANAGLISEISKLVEERKSRALWKI
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatggtgatttaacttcctttcaaaccggcgtagccgttccccttttcagtctt
cacagcaagcacagcattggcattggcgaattcctggacttgattccgttcgcccagtgg
gccaagttctgcggattcaatatcattcagcttttgcctgtaaacgataccggctccgag
ccgagtccttacagtgcccgcagcgcatttgccttgaacccggtgttcatcaacgtgcag
tccgtcgaaggcgctaccgtcctcgaacatgaaatcgaaaaggctcgtgcgcagtttgct
ggtattgaacgagttgattattaccgcattaccacgtggaagcgcgccatcctccgcaag
atttttgataaccagtatgatgtcctgaaatcttcaaagaagctcctggcctggattgac
aaaaactcctgggtcaagtcctattgcgtctactgcacgctcaaggctcagaacaacgaa
gctagctggaaggactggaaaaagttccagaacccctccgctgccgatgtcgacaagctt
tggatgaagaactacagggacgtgctgttccaggcttggatgcagtacactgccgaaggc
cagtttaccgccgccgtgaacgaagtctccaaactcgggctccgcttgaagggcgacgtg
cctatcctcatcaacgaagacagtgccgacgtgtggtttgaccgcaagtacttctcgctt
gccgaccgcgctggtgcgcctcctgacatgtttagctacggtggccagaactggggtttc
ccgacttaccgttgggacgtacttgaagccgatgacttcggctggtggcgccgccgtttg
gctcaggctagcaagttctatcacgcctaccgcattgaccacgtgctcggattcttccgc
atttgggcaattcctgaatctgaatcaacgggtatcttgggccgcttccagccgtccatt
ccgcttacatgggatgtgctccgcaatgcggggttctaccgtgaaacgcttgaatatttg
cgtcgtccgaacttctctgtggaccagttgcgcgaattcctcggcagcgaaacggacagg
cttatctctctgtattttgaaaatttgccgggaaagttcgaccgctttgtcattaagccg
gaatacttgtcggaacgcgcaattctttcgcttgacgaaccgcaagaagtcaaggattcc
atgctccgcgtttactggaaccgcgtatttatcccgacgggtgacgaaaatacgttctac
ccgtactggtactggtacaaccagccggtgctctttacgcttccgcagaatgaacaagat
aaactccacgatttgattggccagaacgaacaggctcagaatgctctctgggaacagaat
gccatgaagcttttgtctgtactcgccaacgaaacggatatgctcgtttgtgccgaagac
cttggcgccgtgccgccgtgcgtgccgactgtgctcaagaagctcgatatcatgtcgctg
cgcattgaacgctgggcccgcaactggaatgttccgtattctccgtactacagcatggac
gaatacccgcgtctttccgtttgcacgacgagctgccacgatacttcgacgctccgcggt
atgtgggaagaacctgactttgacaagggcttctactggtctcacgccggtttgccgggt
gttgcccctgaaaagcttacgccgccggtggtgcacgatatcttgtcgcatgtgtttact
gcaaatagtttgttctgcataccgccaatccaggactactttgcactttcggcttcgctt
tctgattgcgacccgaaggaagaacgcgtcaacattccgggaacggtcggtggcaagaac
tggacatatcgcacaccgtgcagtgtcgaggacttgcttgccaatgcgggcttgatttcg
gagattagcaaacttgtcgaagaacgtaagtcccgtgctctctggaaaatatag

DBGET integrated database retrieval system