KEGG   Fibrobacter succinogenes: FSU_1370Help
Entry
FSU_1370          CDS       T02105                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fsc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fsc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1598908..1599450
Genome map
AA seq 180 aa AA seqDB search
MTIYDFTLTDGKGNEIPLSKFKGQVMLIVNTATGCGFTPHYKPIEKMYTDFHDKGFEVID
IPCNQFMGQTPGTDDEIHEFCTLKYGTTFPQMKKSDVNGPNELPLYTYLKSKIGFEGFGF
GVKAAAMAMLLKKIDKDYKNNPDIKWNFTKFVIDRAGNVVARFEPTAKMEDVRSCVEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctacgacttcacacttaccgatggtaaaggcaacgaaattccactctctaaa
ttcaagggccaagtcatgctcatcgtgaacacggcgaccggctgcggtttcaccccacat
tacaagccgatcgaaaagatgtacacagacttccacgacaagggcttcgaagtcatcgac
attccatgcaaccagttcatgggccagacccctggcacagacgacgaaattcatgaattc
tgcacgctcaagtacggcaccacgttcccgcagatgaaaaagtctgacgtgaacggaccc
aacgagctcccgctttacacctacctgaaatccaaaataggctttgaaggtttcggattc
ggcgtcaaggcggcagcaatggccatgcttctgaagaagatcgacaaggattacaagaat
aatcctgatatcaagtggaacttcacaaagttcgtcatcgaccgcgcaggcaacgttgtc
gcccgttttgaacccactgccaaaatggaggacgtacgttcttgcgttgaaaagctactt
tag

DBGET integrated database retrieval system