KEGG   Fibrobacter succinogenes: FSU_1370Help
Entry
FSU_1370          CDS       T02105                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FSU_1370
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FSU_1370
Enzymes [BR:fsc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FSU_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1598908..1599450
Genome map
AA seq 180 aa AA seqDB search
MTIYDFTLTDGKGNEIPLSKFKGQVMLIVNTATGCGFTPHYKPIEKMYTDFHDKGFEVID
IPCNQFMGQTPGTDDEIHEFCTLKYGTTFPQMKKSDVNGPNELPLYTYLKSKIGFEGFGF
GVKAAAMAMLLKKIDKDYKNNPDIKWNFTKFVIDRAGNVVARFEPTAKMEDVRSCVEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctacgacttcacacttaccgatggtaaaggcaacgaaattccactctctaaa
ttcaagggccaagtcatgctcatcgtgaacacggcgaccggctgcggtttcaccccacat
tacaagccgatcgaaaagatgtacacagacttccacgacaagggcttcgaagtcatcgac
attccatgcaaccagttcatgggccagacccctggcacagacgacgaaattcatgaattc
tgcacgctcaagtacggcaccacgttcccgcagatgaaaaagtctgacgtgaacggaccc
aacgagctcccgctttacacctacctgaaatccaaaataggctttgaaggtttcggattc
ggcgtcaaggcggcagcaatggccatgcttctgaagaagatcgacaaggattacaagaat
aatcctgatatcaagtggaacttcacaaagttcgtcatcgaccgcgcaggcaacgttgtc
gcccgttttgaacccactgccaaaatggaggacgtacgttcttgcgttgaaaagctactt
tag

DBGET integrated database retrieval system