KEGG   Fibrobacter succinogenes: FSU_1604Help
Entry
FSU_1604          CDS       T02105                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fsc  Fibrobacter succinogenes
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fsc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1855252..1855848
Genome map
AA seq 198 aa AA seqDB search
MNVEPQSLENLISEFASLPGIGLKTARRLAYHMLSRKKGDVERFADSLMQAAEKVHPCPR
CHAFTDEDICPTCRAREGAKSICVVEKNSDILPFERSSVHKGLYFVLGGVISPLDGIGPE
ALHLPQLVERIKAENIEELVLALGSSPEADSTALMIDRMLAGVNVKRTRLARGIPMGSDL
EFIDEVTMLRAFEGRVSL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagaaccgcaaagcctagaaaacctgatttctgaatttgcctcccttccaggg
attggactaaagacggcacgccgcctcgcctaccacatgctttcgcgcaaaaaaggcgat
gtcgagcgctttgccgatagcttgatgcaggccgccgaaaaggtccacccgtgcccgcgc
tgccacgccttcaccgacgaagacatctgccctacgtgcagagcccgcgaaggcgccaag
tccatctgcgttgtcgaaaaaaattcagacattctgccgttcgaacgttcgtctgtccat
aaaggtctttactttgtcctcggcggtgtgatttccccgctcgacggcatcggccccgaa
gcactccacctgccgcaactcgtggaacgcatcaaagcagaaaacatcgaagaacttgtc
cttgcactcggctctagccccgaagccgacagcacagccctcatgattgaccgcatgctc
gccggcgtcaatgtcaagcgcacccgccttgcccgcggcatcccgatgggcagcgacctg
gaattcatcgacgaagtcaccatgcttcgcgcattcgaagggagagtttccttatga

DBGET integrated database retrieval system