KEGG   Fibrobacter succinogenes: FSU_1645Help
Entry
FSU_1645          CDS       T02105                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsc  Fibrobacter succinogenes
Pathway
fsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FSU_1645 (recD)
Enzymes [BR:fsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FSU_1645 (recD)
DNA repair and recombination proteins [BR:fsc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FSU_1645 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD UvrD-helicase DUF2075 AAA_22 ResIII AAA_16 T2SSE RNA_helicase FtsK_SpoIIIE UvrD_C NTPase_1 AAA_28 Herpes_Helicase Paramyxo_PCT AAA
Motif
Other DBs
NCBI-ProteinID: ADL25078
UniProt: C9RQA9
Position
1911958..1914078
Genome map
AA seq 706 aa AA seqDB search
MENKILAIESIDDFIEDLIEMRGLVPLDKHLLHLLFEIKSDIPLHTRKFLTLCMSLLDDG
NTRVPLDAAQFTDMWTRKWNGLVMLRVSTAEEDIDENAFATADDFASIISEGIQDILTND
FSAIMESRETDTESAEDSLSKPFILAKRPNGTHLYFTKHFDAKCVIEKAANILFKNGRKP
SKDEIAQCTEKVANMCKLKDGKKFIIKERQAEAIIRGQTENLVVTGGPGTGKTTVVLYIL
WNLLASHSEMLDWNIYLAAPSGKAADRMRESLVGGLSNILDEQKTGDNERIFRKLNELES
STIHRLLRFSRSKGCFTFNRKEQFPKNSIFVIDEASMIDIEMFAALLEAIPEGARIFILG
DSFQLPSVDSGAVLGEILKVQSGKNFSVKLNESNRFDDRSNIGKLAAEIKEVAECNDSNK
FVPHKFTITGEEPVSENENTSFPEFKDKVLYKCLETDDKPLTKKEEEKLIESFIGKWSEE
FAKLPELAEQINPQRTGIEADDPDKIETKRRNDIWRLSLTKRILCAERRGLRGIENINKK
VCSKIKSLWRTKKKKEGKTVQWDDSGYFPGQLLIITKNQEMFKLYNGDTGIVVFDGNTPC
LMLKKAAPHRKDLQKTRDDYVFYPLSVLPEDSISTAFAITIHKSQGSEYNHVTMFLPTKI
GHPLLTNQIIYTGITRAMESVTIIANDDTFRAAVTTVSERDTGISL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaatactcgctatagaatcaattgacgatttcattgaagacctcattgaa
atgcgcgggctcgttccgcttgacaagcacttgctccacctgctttttgaaatcaagagc
gacattccactccatacacgaaaattcctgacgctctgtatgtcgctccttgacgacggc
aacacacgcgttccgctagacgcagcgcagttcacggacatgtggacccgcaaatggaac
ggcctcgtgatgctccgcgtcagcactgccgaagaagatattgacgaaaacgcctttgca
accgcagacgattttgcaagcatcatcagcgaaggcattcaagacatcttgactaacgac
ttttccgccatcatggaaagccgcgagaccgacacagaatccgccgaagactccttgagc
aagccgttcattctcgccaagcgcccgaacggaacacacctctatttcactaagcacttt
gacgccaaatgcgtgattgaaaaagcggcgaatattttgttcaaaaacggtcgcaagcca
agcaaagacgaaattgcgcagtgtactgaaaaagtagccaatatgtgcaagcttaaagac
ggcaaaaagttcatcatcaaggaacgccaagccgaagccatcatccgcggacaaacagaa
aacctcgtcgttacaggtggcccgggtaccggcaagacaaccgtcgttctctacattctg
tggaacctgctcgcaagccatagcgaaatgcttgactggaacatctatcttgcagctccg
agcggcaaggcagccgaccgcatgcgcgaaagccttgtcggtggtctctcaaatattctt
gacgaacaaaagaccggcgataacgagcgtattttccgcaagctgaacgaactcgaaagc
agcaccatccaccgtctgctccgattctctagaagcaaaggttgcttcactttcaaccgc
aaagaacaattcccaaagaattcaatcttcgtcattgacgaagcgagcatgattgacatc
gaaatgttcgcggccctccttgaagccattcccgaaggcgcacgcatattcatcctcggt
gattcattccagctcccttctgttgattccggcgccgtcctcggcgaaatcttgaaagtg
caatccggcaagaatttttccgtcaagctcaacgaatccaaccgctttgacgaccgttca
aacatcggtaaactcgctgcagaaatcaaggaagttgccgaatgcaatgacagcaacaag
ttcgtccctcacaaatttaccattaccggcgaagaacccgtttccgaaaatgaaaacact
tcgttcccagaattcaaggataaagttctttacaaatgtcttgaaacagacgacaagccg
cttacaaaaaaagaagaggaaaagctcatcgaatcgttcattggcaaatggtctgaagaa
ttcgctaagctccccgaactcgccgagcaaatcaacccgcaacgcaccggcattgaagca
gatgaccccgataaaattgaaacaaaacgtcgcaatgacatttggcgactttcgttgaca
aaacgaatcctctgcgccgaacgtcgtggcctccgaggcattgaaaacatcaataaaaaa
gtttgttctaaaatcaagagcctctggcgcaccaaaaagaaaaaagaaggcaaaacagtc
caatgggacgactccggttacttccccggacagctcctgattatcaccaagaaccaggaa
atgttcaaactctacaacggcgacacgggaatcgtcgtctttgacggcaacaccccctgc
ctcatgctcaaaaaagcggctccgcatagaaaggatctccaaaagacccgcgacgactat
gtattctaccccctctcggtcctccccgaagattccatctcaacagcgtttgccatcacc
atacacaagtcacaaggctccgagtacaatcacgtgaccatgttcctgccgaccaaaatc
ggccaccccctcctcaccaaccaaatcatctacacaggcatcacccgtgccatggagagc
gtcaccatcatagcaaacgatgacacattcagagccgccgtcaccaccgtcagcgagcgc
gatacgggaatttcgctatag

DBGET integrated database retrieval system