KEGG   Fibrobacter succinogenes: FSU_1645Help
Entry
FSU_1645          CDS       T02105                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsc  Fibrobacter succinogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FSU_1645 (recD)
Enzymes [BR:fsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FSU_1645 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911958..1914078
Genome map
AA seq 706 aa AA seqDB search
MENKILAIESIDDFIEDLIEMRGLVPLDKHLLHLLFEIKSDIPLHTRKFLTLCMSLLDDG
NTRVPLDAAQFTDMWTRKWNGLVMLRVSTAEEDIDENAFATADDFASIISEGIQDILTND
FSAIMESRETDTESAEDSLSKPFILAKRPNGTHLYFTKHFDAKCVIEKAANILFKNGRKP
SKDEIAQCTEKVANMCKLKDGKKFIIKERQAEAIIRGQTENLVVTGGPGTGKTTVVLYIL
WNLLASHSEMLDWNIYLAAPSGKAADRMRESLVGGLSNILDEQKTGDNERIFRKLNELES
STIHRLLRFSRSKGCFTFNRKEQFPKNSIFVIDEASMIDIEMFAALLEAIPEGARIFILG
DSFQLPSVDSGAVLGEILKVQSGKNFSVKLNESNRFDDRSNIGKLAAEIKEVAECNDSNK
FVPHKFTITGEEPVSENENTSFPEFKDKVLYKCLETDDKPLTKKEEEKLIESFIGKWSEE
FAKLPELAEQINPQRTGIEADDPDKIETKRRNDIWRLSLTKRILCAERRGLRGIENINKK
VCSKIKSLWRTKKKKEGKTVQWDDSGYFPGQLLIITKNQEMFKLYNGDTGIVVFDGNTPC
LMLKKAAPHRKDLQKTRDDYVFYPLSVLPEDSISTAFAITIHKSQGSEYNHVTMFLPTKI
GHPLLTNQIIYTGITRAMESVTIIANDDTFRAAVTTVSERDTGISL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaatactcgctatagaatcaattgacgatttcattgaagacctcattgaa
atgcgcgggctcgttccgcttgacaagcacttgctccacctgctttttgaaatcaagagc
gacattccactccatacacgaaaattcctgacgctctgtatgtcgctccttgacgacggc
aacacacgcgttccgctagacgcagcgcagttcacggacatgtggacccgcaaatggaac
ggcctcgtgatgctccgcgtcagcactgccgaagaagatattgacgaaaacgcctttgca
accgcagacgattttgcaagcatcatcagcgaaggcattcaagacatcttgactaacgac
ttttccgccatcatggaaagccgcgagaccgacacagaatccgccgaagactccttgagc
aagccgttcattctcgccaagcgcccgaacggaacacacctctatttcactaagcacttt
gacgccaaatgcgtgattgaaaaagcggcgaatattttgttcaaaaacggtcgcaagcca
agcaaagacgaaattgcgcagtgtactgaaaaagtagccaatatgtgcaagcttaaagac
ggcaaaaagttcatcatcaaggaacgccaagccgaagccatcatccgcggacaaacagaa
aacctcgtcgttacaggtggcccgggtaccggcaagacaaccgtcgttctctacattctg
tggaacctgctcgcaagccatagcgaaatgcttgactggaacatctatcttgcagctccg
agcggcaaggcagccgaccgcatgcgcgaaagccttgtcggtggtctctcaaatattctt
gacgaacaaaagaccggcgataacgagcgtattttccgcaagctgaacgaactcgaaagc
agcaccatccaccgtctgctccgattctctagaagcaaaggttgcttcactttcaaccgc
aaagaacaattcccaaagaattcaatcttcgtcattgacgaagcgagcatgattgacatc
gaaatgttcgcggccctccttgaagccattcccgaaggcgcacgcatattcatcctcggt
gattcattccagctcccttctgttgattccggcgccgtcctcggcgaaatcttgaaagtg
caatccggcaagaatttttccgtcaagctcaacgaatccaaccgctttgacgaccgttca
aacatcggtaaactcgctgcagaaatcaaggaagttgccgaatgcaatgacagcaacaag
ttcgtccctcacaaatttaccattaccggcgaagaacccgtttccgaaaatgaaaacact
tcgttcccagaattcaaggataaagttctttacaaatgtcttgaaacagacgacaagccg
cttacaaaaaaagaagaggaaaagctcatcgaatcgttcattggcaaatggtctgaagaa
ttcgctaagctccccgaactcgccgagcaaatcaacccgcaacgcaccggcattgaagca
gatgaccccgataaaattgaaacaaaacgtcgcaatgacatttggcgactttcgttgaca
aaacgaatcctctgcgccgaacgtcgtggcctccgaggcattgaaaacatcaataaaaaa
gtttgttctaaaatcaagagcctctggcgcaccaaaaagaaaaaagaaggcaaaacagtc
caatgggacgactccggttacttccccggacagctcctgattatcaccaagaaccaggaa
atgttcaaactctacaacggcgacacgggaatcgtcgtctttgacggcaacaccccctgc
ctcatgctcaaaaaagcggctccgcatagaaaggatctccaaaagacccgcgacgactat
gtattctaccccctctcggtcctccccgaagattccatctcaacagcgtttgccatcacc
atacacaagtcacaaggctccgagtacaatcacgtgaccatgttcctgccgaccaaaatc
ggccaccccctcctcaccaaccaaatcatctacacaggcatcacccgtgccatggagagc
gtcaccatcatagcaaacgatgacacattcagagccgccgtcaccaccgtcagcgagcgc
gatacgggaatttcgctatag

DBGET integrated database retrieval system