KEGG   Fibrobacter succinogenes: FSU_1645Help
Entry
FSU_1645          CDS       T02105                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsc  Fibrobacter succinogenes
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fsc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1911958..1914078
Genome map
AA seq 706 aa AA seqDB search
MENKILAIESIDDFIEDLIEMRGLVPLDKHLLHLLFEIKSDIPLHTRKFLTLCMSLLDDG
NTRVPLDAAQFTDMWTRKWNGLVMLRVSTAEEDIDENAFATADDFASIISEGIQDILTND
FSAIMESRETDTESAEDSLSKPFILAKRPNGTHLYFTKHFDAKCVIEKAANILFKNGRKP
SKDEIAQCTEKVANMCKLKDGKKFIIKERQAEAIIRGQTENLVVTGGPGTGKTTVVLYIL
WNLLASHSEMLDWNIYLAAPSGKAADRMRESLVGGLSNILDEQKTGDNERIFRKLNELES
STIHRLLRFSRSKGCFTFNRKEQFPKNSIFVIDEASMIDIEMFAALLEAIPEGARIFILG
DSFQLPSVDSGAVLGEILKVQSGKNFSVKLNESNRFDDRSNIGKLAAEIKEVAECNDSNK
FVPHKFTITGEEPVSENENTSFPEFKDKVLYKCLETDDKPLTKKEEEKLIESFIGKWSEE
FAKLPELAEQINPQRTGIEADDPDKIETKRRNDIWRLSLTKRILCAERRGLRGIENINKK
VCSKIKSLWRTKKKKEGKTVQWDDSGYFPGQLLIITKNQEMFKLYNGDTGIVVFDGNTPC
LMLKKAAPHRKDLQKTRDDYVFYPLSVLPEDSISTAFAITIHKSQGSEYNHVTMFLPTKI
GHPLLTNQIIYTGITRAMESVTIIANDDTFRAAVTTVSERDTGISL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaaatactcgctatagaatcaattgacgatttcattgaagacctcattgaa
atgcgcgggctcgttccgcttgacaagcacttgctccacctgctttttgaaatcaagagc
gacattccactccatacacgaaaattcctgacgctctgtatgtcgctccttgacgacggc
aacacacgcgttccgctagacgcagcgcagttcacggacatgtggacccgcaaatggaac
ggcctcgtgatgctccgcgtcagcactgccgaagaagatattgacgaaaacgcctttgca
accgcagacgattttgcaagcatcatcagcgaaggcattcaagacatcttgactaacgac
ttttccgccatcatggaaagccgcgagaccgacacagaatccgccgaagactccttgagc
aagccgttcattctcgccaagcgcccgaacggaacacacctctatttcactaagcacttt
gacgccaaatgcgtgattgaaaaagcggcgaatattttgttcaaaaacggtcgcaagcca
agcaaagacgaaattgcgcagtgtactgaaaaagtagccaatatgtgcaagcttaaagac
ggcaaaaagttcatcatcaaggaacgccaagccgaagccatcatccgcggacaaacagaa
aacctcgtcgttacaggtggcccgggtaccggcaagacaaccgtcgttctctacattctg
tggaacctgctcgcaagccatagcgaaatgcttgactggaacatctatcttgcagctccg
agcggcaaggcagccgaccgcatgcgcgaaagccttgtcggtggtctctcaaatattctt
gacgaacaaaagaccggcgataacgagcgtattttccgcaagctgaacgaactcgaaagc
agcaccatccaccgtctgctccgattctctagaagcaaaggttgcttcactttcaaccgc
aaagaacaattcccaaagaattcaatcttcgtcattgacgaagcgagcatgattgacatc
gaaatgttcgcggccctccttgaagccattcccgaaggcgcacgcatattcatcctcggt
gattcattccagctcccttctgttgattccggcgccgtcctcggcgaaatcttgaaagtg
caatccggcaagaatttttccgtcaagctcaacgaatccaaccgctttgacgaccgttca
aacatcggtaaactcgctgcagaaatcaaggaagttgccgaatgcaatgacagcaacaag
ttcgtccctcacaaatttaccattaccggcgaagaacccgtttccgaaaatgaaaacact
tcgttcccagaattcaaggataaagttctttacaaatgtcttgaaacagacgacaagccg
cttacaaaaaaagaagaggaaaagctcatcgaatcgttcattggcaaatggtctgaagaa
ttcgctaagctccccgaactcgccgagcaaatcaacccgcaacgcaccggcattgaagca
gatgaccccgataaaattgaaacaaaacgtcgcaatgacatttggcgactttcgttgaca
aaacgaatcctctgcgccgaacgtcgtggcctccgaggcattgaaaacatcaataaaaaa
gtttgttctaaaatcaagagcctctggcgcaccaaaaagaaaaaagaaggcaaaacagtc
caatgggacgactccggttacttccccggacagctcctgattatcaccaagaaccaggaa
atgttcaaactctacaacggcgacacgggaatcgtcgtctttgacggcaacaccccctgc
ctcatgctcaaaaaagcggctccgcatagaaaggatctccaaaagacccgcgacgactat
gtattctaccccctctcggtcctccccgaagattccatctcaacagcgtttgccatcacc
atacacaagtcacaaggctccgagtacaatcacgtgaccatgttcctgccgaccaaaatc
ggccaccccctcctcaccaaccaaatcatctacacaggcatcacccgtgccatggagagc
gtcaccatcatagcaaacgatgacacattcagagccgccgtcaccaccgtcagcgagcgc
gatacgggaatttcgctatag

DBGET integrated database retrieval system