KEGG   Fibrobacter succinogenes: FSU_1790Help
Entry
FSU_1790          CDS       T02105                                 

Definition
putative phosphofructokinase, alpha subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FSU_1790
   01230 Biosynthesis of amino acids
    FSU_1790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FSU_1790
   00030 Pentose phosphate pathway
    FSU_1790
   00051 Fructose and mannose metabolism
    FSU_1790
   00052 Galactose metabolism
    FSU_1790
  Energy metabolism
   00680 Methane metabolism
    FSU_1790
Enzymes [BR:fsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FSU_1790
Protein phosphatases and associated proteins [BR:fsc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FSU_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2083641..2084978
Genome map
AA seq 445 aa AA seqDB search
MTQDDIIKNPLDYDLSIETVGKGTLKSPMNGVPFVSENDKVSLTTDVNLISEYLAKGIPV
PSLEVAGPRQTIFHDPAWTRAGIVTCGGLCPGLNNVIKGLVQVLWFDYGVRNIFGIPYGY
RGLNPNYGYSPIVLDPDVVDAIQEDGGTILGSSRGMQDPAIMVDTLMRLNINVLFCIGGD
GTLRGAHAIAEEVKKRKQPISIIGIPKTIDNDLNLIDRTFGFETAVLSATDVITSAHIEA
NGAFNGLGLVKLMGRDSGFIAAYASLATTVVNICLVPEVPFTLDGLFKALESRYASGKTH
AVIAVAEGAGQELFKNQEERRDASGNILKNDIGEFLTHKIKEHFDSVGKEINIKYFDPSY
TVRSIPAKGTDAIFCFQLAENAVHAGMAGKTDMVVGSMNNVFSHVPIEYAVSERKKINPN
GPLWHAVLGITRQQDYFSGKGKRSK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggacgatatcatcaagaatccgttggattatgatctttccattgaaaccgtt
ggcaagggcacgcttaagtccccgatgaacggcgttcctttcgtttcggaaaacgacaag
gtcagccttaccactgacgtcaatctcatctctgaatacttagcgaagggtatcccggta
ccttcactcgaagtggccggccctcgacagacaattttccacgaccccgcctggacacgt
gcaggcatcgtcacatgcggtggtctctgcccaggtcttaacaacgtgatcaagggcctt
gtacaagtgctctggttcgactacggcgtgaggaacatcttcggtatcccgtacggctac
cgtggcttgaacccgaattacggttactcccccatcgtgcttgacccggatgtggtcgat
gccattcaggaagacggcggtacgattctcggtagctcccgcggcatgcaggacccggcc
atcatggtcgatacgctcatgcgactcaacatcaacgtgttgttctgcatcggtggtgac
ggtacgctccgtggcgcacatgctattgccgaagaagtcaagaagcgtaaacagcccatc
tcgattatcggcatcccgaagacgatcgataacgacttgaacttgatcgacaggacgttc
ggttttgaaaccgccgtgctcagcgccacagacgtgattaccagcgcccacattgaagca
aacggtgcattcaatggtcttggcctagtgaagctcatgggtcgtgactccggctttatc
gccgcgtatgcatcgcttgcaacaacagttgtgaacatctgcctcgttcccgaagttccc
tttacgcttgacgggctcttcaaggctctcgaaagccgttacgccagcggcaagactcac
gccgtgatcgccgtcgccgaaggcgccggacaggaacttttcaaaaaccaggaagaacgc
agggacgcaagcggtaacattctgaagaacgatatcggtgaattcctgacccacaagatc
aaggaacatttcgatagcgtcggcaaggaaatcaacatcaagtactttgacccgagctac
acggtgcgtagcatcccggcgaaaggcacggacgccattttctgcttccagctcgcagaa
aacgcagtacacgcaggcatggcaggcaagacggacatggtcgttggcagcatgaacaac
gtattctcgcacgtgcctatcgaatacgccgtgagcgaacgcaagaaaatcaaccccaat
ggccccctgtggcatgccgttctcggtatcacgcgccagcaggactatttctccggcaag
ggcaaacgcagcaagtaa

DBGET integrated database retrieval system