KEGG   Fibrobacter succinogenes: FSU_1790Help
Entry
FSU_1790          CDS       T02105                                 

Definition
(GenBank) putative phosphofructokinase, alpha subunit
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsc  Fibrobacter succinogenes
Pathway
fsc00010  Glycolysis / Gluconeogenesis
fsc00030  Pentose phosphate pathway
fsc00051  Fructose and mannose metabolism
fsc00052  Galactose metabolism
fsc00680  Methane metabolism
fsc01100  Metabolic pathways
fsc01110  Biosynthesis of secondary metabolites
fsc01120  Microbial metabolism in diverse environments
fsc01130  Biosynthesis of antibiotics
fsc01200  Carbon metabolism
fsc01230  Biosynthesis of amino acids
fsc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FSU_1790
   00030 Pentose phosphate pathway
    FSU_1790
   00051 Fructose and mannose metabolism
    FSU_1790
   00052 Galactose metabolism
    FSU_1790
  Energy metabolism
   00680 Methane metabolism
    FSU_1790
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FSU_1790
Enzymes [BR:fsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FSU_1790
Protein phosphatases and associated proteins [BR:fsc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FSU_1790
Messenger RNA biogenesis [BR:fsc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FSU_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADL26764
UniProt: C9RQT5
Position
2083641..2084978
Genome map
AA seq 445 aa AA seqDB search
MTQDDIIKNPLDYDLSIETVGKGTLKSPMNGVPFVSENDKVSLTTDVNLISEYLAKGIPV
PSLEVAGPRQTIFHDPAWTRAGIVTCGGLCPGLNNVIKGLVQVLWFDYGVRNIFGIPYGY
RGLNPNYGYSPIVLDPDVVDAIQEDGGTILGSSRGMQDPAIMVDTLMRLNINVLFCIGGD
GTLRGAHAIAEEVKKRKQPISIIGIPKTIDNDLNLIDRTFGFETAVLSATDVITSAHIEA
NGAFNGLGLVKLMGRDSGFIAAYASLATTVVNICLVPEVPFTLDGLFKALESRYASGKTH
AVIAVAEGAGQELFKNQEERRDASGNILKNDIGEFLTHKIKEHFDSVGKEINIKYFDPSY
TVRSIPAKGTDAIFCFQLAENAVHAGMAGKTDMVVGSMNNVFSHVPIEYAVSERKKINPN
GPLWHAVLGITRQQDYFSGKGKRSK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggacgatatcatcaagaatccgttggattatgatctttccattgaaaccgtt
ggcaagggcacgcttaagtccccgatgaacggcgttcctttcgtttcggaaaacgacaag
gtcagccttaccactgacgtcaatctcatctctgaatacttagcgaagggtatcccggta
ccttcactcgaagtggccggccctcgacagacaattttccacgaccccgcctggacacgt
gcaggcatcgtcacatgcggtggtctctgcccaggtcttaacaacgtgatcaagggcctt
gtacaagtgctctggttcgactacggcgtgaggaacatcttcggtatcccgtacggctac
cgtggcttgaacccgaattacggttactcccccatcgtgcttgacccggatgtggtcgat
gccattcaggaagacggcggtacgattctcggtagctcccgcggcatgcaggacccggcc
atcatggtcgatacgctcatgcgactcaacatcaacgtgttgttctgcatcggtggtgac
ggtacgctccgtggcgcacatgctattgccgaagaagtcaagaagcgtaaacagcccatc
tcgattatcggcatcccgaagacgatcgataacgacttgaacttgatcgacaggacgttc
ggttttgaaaccgccgtgctcagcgccacagacgtgattaccagcgcccacattgaagca
aacggtgcattcaatggtcttggcctagtgaagctcatgggtcgtgactccggctttatc
gccgcgtatgcatcgcttgcaacaacagttgtgaacatctgcctcgttcccgaagttccc
tttacgcttgacgggctcttcaaggctctcgaaagccgttacgccagcggcaagactcac
gccgtgatcgccgtcgccgaaggcgccggacaggaacttttcaaaaaccaggaagaacgc
agggacgcaagcggtaacattctgaagaacgatatcggtgaattcctgacccacaagatc
aaggaacatttcgatagcgtcggcaaggaaatcaacatcaagtactttgacccgagctac
acggtgcgtagcatcccggcgaaaggcacggacgccattttctgcttccagctcgcagaa
aacgcagtacacgcaggcatggcaggcaagacggacatggtcgttggcagcatgaacaac
gtattctcgcacgtgcctatcgaatacgccgtgagcgaacgcaagaaaatcaaccccaat
ggccccctgtggcatgccgttctcggtatcacgcgccagcaggactatttctccggcaag
ggcaaacgcagcaagtaa

DBGET integrated database retrieval system