KEGG   Fibrobacter succinogenes: FSU_2914Help
Entry
FSU_2914          CDS       T02105                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fsc  Fibrobacter succinogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FSU_2914
Enzymes [BR:fsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FSU_2914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3355722..3358454
Genome map
AA seq 910 aa AA seqDB search
MFMKKVFALLTCAAVTSAMAVTASRVGPVSTYGELVANGGKLSGSCPEYSQKAVQVKGMS
LFWSSGNTYSTDFYSEKGINRLVDDMGIEVVRFALGAADEKFNSSGRSYTTGGEGFQKAL
LKSVVNAAIDKDIYVIIDWHIESSDGFTSDAVKFFEYAAQEYGQYNNVIFEIWNEPTGSM
EAVKQHADQVIPVIRKYSDNLILVGSPGWSSQPNACASAGINDKNYGCTLHFYAATHYMG
DGGYNKAAETAMAAGVPVFATEWGTVNANGDGQPDEGSSNKWVEWMAQKGVSWTNWNASA
MNETSAAFANAVFENGFTYTNSGKYVKGKLGGASYKDCGLQNGSASEESGFSAGVANGAT
TSILDDMEDGDRYGYLGGAWAAVEDQENGGASSISNEKIEDDFGNTTYKVVYPVSGDTKN
TSKYVAALKDVKIGKGSLTYGPYIKMFLTLLKEPAKDSPKAYADFSKCKTIKYKYKGASH
NFAIETTDVTDYNYHRVNKDASEGWKEVEITTDMLKQETWGDDSRSKPIKMENATRLSWE
IKGLEKVPDDMNQPKYPYLYVDDVKCDGLSFTAVSGGASENPKSSSSAAVGQSSSSVVAG
SSSSAKATSSSSAIVPGSSATVTYKTVVDIDDVEDLDEVLKTKGTWYAYTDKEPGGKSSI
SNVYDQKLGGYVVAFPGTEDPTNGTKGFVGLKDINWDQGTYTEAPFVALGLNTNADTSKG
IDLSKCGAISYRYKGSAHTFKVQDGSVTDYAYHEYPLDDSQVWKTMVINIEDIAQPNWTQ
DPKDLNWGAIKKMAWEVIGYKGIVYQPTINYLYVDDLKCVEVPKVGFKTVARAASGIKVG
FKGNMLNVNFAKAGEARIQVFDMMGHVVDSRVANVSAGANQFSLKNMANGNYVVRVMMNG
AAKTARISIK
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaaaaaagtcttcgcattattgacgtgcgctgccgtgacctctgccatggca
gtgactgctagccgtgttggtccggtgagcacatacggtgaactcgtcgcaaatggtggc
aagctttctggttcttgcccggaatactctcaaaaggctgttcaagtcaagggtatgagc
ctcttctggagctcgggcaacacctattctaccgacttctactctgaaaagggcatcaac
cgtttggttgacgacatgggtatcgaagttgtgcgttttgctcttggtgccgctgacgaa
aagttcaacagctcgggccgttcttacacgacgggtggcgaaggcttccagaaggctttg
ctcaagtctgtggtgaacgctgctattgacaaagacatttacgtgattatcgactggcac
atcgaaagctctgacggttttacgtctgacgctgtcaagttctttgaatacgcagctcag
gaatatggccagtataacaacgtgattttcgaaatttggaacgaaccgaccggaagcatg
gaagccgtgaagcagcatgccgatcaggttattccggtaattcgtaagtattctgataac
ctcatcctcgtgggtagcccgggatggtccagccagccgaatgcttgcgcttccgcaggc
atcaacgacaagaactatggttgtacgctccacttctatgccgcaactcactatatgggc
gatggcggttacaacaaggctgcagaaacggctatggctgcaggtgtgcctgtgtttgct
accgaatggggtaccgtcaatgctaacggtgatggccagccggatgaaggctccagcaac
aagtgggtagaatggatggctcagaagggcgtgtcctggacgaactggaacgcttctgcc
atgaacgaaacttctgctgcatttgctaatgccgtgtttgaaaatggtttcacttacacc
aattctggtaagtatgtgaagggcaagctcggtggtgcatcttataaggattgcggcctc
cagaatggttctgcttctgaagaaagtggcttctctgctggcgttgccaatggcgctaca
acttccattctcgatgacatggaagatggcgaccgttatggttacctcggtggtgcatgg
gctgctgttgaagaccaggaaaacggtggcgcaagctctatttctaacgaaaagattgaa
gatgactttggcaacacgacctataaggttgtctacccggtcagcggcgataccaagaat
acgtccaagtatgttgcagcccttaaggatgttaagatcggtaagggttcccttacttac
ggtccgtacatcaagatgttcctcacgctcttgaaggaaccagcaaaggattccccgaag
gcttatgcagacttctccaagtgcaagaccatcaagtacaagtacaagggtgcaagccat
aacttcgccatcgaaacgaccgatgttaccgactacaactatcaccgcgtgaacaaggac
gcttctgaaggttggaaggaagtcgaaattacgacggatatgttgaagcaggaaacctgg
ggtgacgattctcgctccaagccgatcaagatggaaaacgcaactcgtctttcttgggaa
atcaagggcctcgaaaaggttccggacgatatgaaccagcccaagtatccgtacctctat
gtggatgacgtgaagtgcgacggtctttccttcactgccgttagcggtggtgctagcgaa
aatccgaagtcctcttctagtgctgcagttggtcagagctcttcttctgttgttgctggt
tcttctagcagcgcaaaggcaacttcttcttctagcgcaatcgttccgggttcttctgct
acggtaacctacaagactgttgtcgatatcgacgatgttgaagatcttgacgaagttctc
aagacaaagggtacctggtacgcttacacggataaggaaccgggtggaaagtcctctatt
tctaacgtctatgaccagaagcttggtggctatgtggttgccttcccgggtactgaagat
ccgacgaatggcactaagggctttgtgggcttgaaggacatcaattgggatcagggaacc
tatacggaagctccgtttgtggctctcggcctcaacacgaatgctgatacctccaagggt
attgacttgagcaagtgcggtgctatcagctaccgttacaagggttccgctcataccttc
aaggttcaggatggttctgtgacggactacgcttaccacgaatatccgcttgatgattcc
caggtttggaagaccatggtcatcaatatcgaagacattgctcagccgaactggactcaa
gatccgaaggacctcaactggggtgctatcaagaagatggcttgggaagtcattggctac
aagggcattgtctatcagccgacaatcaactacctctatgtggatgatctcaagtgcgtc
gaagtgccgaaggtcggcttcaagacggttgctcgcgctgctagcggcatcaaggtcggc
ttcaagggcaatatgctcaacgtgaactttgcaaaggctggtgaagcacgtatccaggtg
ttcgacatgatgggtcacgttgttgacagccgtgttgctaacgtctctgccggtgcaaac
cagttctctctcaagaacatggctaacggcaactacgttgtgcgtgtgatgatgaacggt
gcagcaaagactgctcgtatctccatcaagtaa

DBGET integrated database retrieval system