KEGG   Fibrobacter succinogenes: FSU_2922Help
Entry
FSU_2922          CDS       T02105                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fsc  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FSU_2922 (tpiA)
   01230 Biosynthesis of amino acids
    FSU_2922 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FSU_2922 (tpiA)
   00051 Fructose and mannose metabolism
    FSU_2922 (tpiA)
   00562 Inositol phosphate metabolism
    FSU_2922 (tpiA)
Enzymes [BR:fsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FSU_2922 (tpiA)
Exosome [BR:fsc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FSU_2922 (tpiA)
  Exosomal proteins of bladder cancer cells
   FSU_2922 (tpiA)
  Exosomal proteins of melanoma cells
   FSU_2922 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3362446..3363207)
Genome map
AA seq 253 aa AA seqDB search
MRQYIIAGNWKMNKTVSESVQLAKDIVEAVKDVKKTEVVIAPTYLAAAKVADVVKGTNVK
LAIQDIHWKDQGAYTGKVSIDMVKEIGAEYVIIGHSEQRQYFHETEETVNLKVKKTLEAG
LKPIICIGETLDQRNGGILKEVLGLQIKGAFKDVSAEDAAKCVLAYEPVWAIGTGVTATD
EQAEETQAYVRSVVKEIYGEAVAEGMRIQYGGSMKGANAAGLLAQKDIDGGLIGGAGLKA
NTFKEIIDAAEAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagtatatcattgctggtaactggaagatgaacaagaccgttagcgaatccgtt
cagctcgctaaggatatcgtggaagccgtcaaggacgtgaagaagaccgaagtcgtgatc
gctccgacttacctcgctgctgctaaggttgcagacgtcgtgaagggcacgaacgtgaag
ctcgctatccaggacatccactggaaggaccagggcgcatacactggtaaggtttccatt
gacatggtcaaggaaatcggtgctgaatacgtgatcatcggtcactccgaacagcgtcag
tacttccacgaaacggaagaaaccgtgaacctcaaggtcaagaagactctcgaagctggc
ctcaagccgatcatctgcattggtgaaactctcgaccagcgcaacggcggcatcctcaag
gaagttctcggcctccagatcaagggcgctttcaaggacgtttctgctgaagacgctgct
aagtgcgttctcgcatacgaaccggtttgggcaatcggtactggcgttaccgctaccgac
gaacaggctgaagaaactcaggcttacgtccgctccgttgttaaggaaatctacggcgaa
gctgttgcagaaggcatgcgcattcagtacggtggctccatgaagggtgccaacgcagct
ggcctcctcgctcagaaggacatcgacggcggtctcattggtggtgcaggcctcaaggct
aacaccttcaaggaaatcatcgacgctgctgaagccaagtaa

DBGET integrated database retrieval system