KEGG   Fibrobacter succinogenes: FSU_2992Help
Entry
FSU_2992          CDS       T02105                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fsc  Fibrobacter succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FSU_2992 (folK)
Enzymes [BR:fsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FSU_2992 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3447383..3447892
Genome map
AA seq 169 aa AA seqDB search
MDSLNRVYIALGSNLPDRSAHLKAGRDMLHRVSAGGWVESPIYETPPVGPEGQGPYFNQV
VSFWYDGDPIKLLYYLKGSELILGRKDRGHWNSREVDLDLLFFGREVCEGRPTIPHSQIY
NRQFVLVPLCDIAPDWVDPKTNKTVKDLLSDLLAKEEKIPFRVIEGEEP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggattctttaaatagagtatatatagcactcggaagcaatcttccagaccgatcggcc
cacttgaaagccgggagggacatgcttcaccgcgtgagcgcgggtggctgggtcgaaagc
ccgatttacgagactcctccagtcggaccggaggggcaggggccatattttaaccaggtt
gtgagcttctggtacgatggtgatccgataaagctactctattatttaaaaggctccgag
cttattcttgggcgcaaggaccgcggtcactggaattccagagaagtggatttagatttg
ctgttctttggacgtgaagtttgtgaagggcgcccgacgattcctcattcgcagatttac
aaccgccagttcgttctcgtgcctctttgcgacatcgctccggactgggtggacccgaag
acgaacaagaccgtgaaggacttgctttcggatttgctcgcgaaagaagaaaagattccg
ttccgcgtcattgaaggggaggaaccctga

DBGET integrated database retrieval system