KEGG   Fibrobacter succinogenes: FSU_3220Help
Entry
FSU_3220          CDS       T02105                                 

Definition
(RefSeq) putative 1-aminocyclopropane-1-carboxylate deaminase
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
fsc  Fibrobacter succinogenes
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:fsc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FSU_3220
Enzymes [BR:fsc01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     FSU_3220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3732475..3733419
Genome map
AA seq 314 aa AA seqDB search
MSTESVLQTPIVNLDNYAGNHLWIKRDDLIPFSFGGNKARKAFGFFREFDAGNYDCIVTY
GSSSSNHCRVVSNMARQRNIPCYIIAPEEASKPTFNSQLMDLFGAEFKVCPVKDVSKTID
EIILNLRAAGKKPYFIAGGGHGNIGTQAYVDCYNEICDFEKKNSVFFDYIFFASGTGTTQ
AGLVCGKMMNGDNRQIIGISIARKNPRGRNVVVDSVKEYLSAKSISFTDNQIEENVVFVD
DYTVDGYGCQNQLVQETIKNALFNYGIPMDSTYVAKAFAGMNDYLVLRKIKSKNVLFIHT
GGTPLFFDSLKDME
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaagcgtacttcagactccaatagttaaccttgataattatgcaggtaat
catctatggattaagcgagatgatctgatacctttttcttttggtggaaataaggctcgc
aaggcattcggcttttttagggagtttgatgccggaaattacgattgcattgtgacttat
ggcagtagcagctcaaatcactgtcgggttgtatcgaatatggcgaggcaaagaaacatt
ccctgctatattatagcacctgaagaggcttccaaaccgacattcaatagtcaattgatg
gatttattcggtgctgaatttaaggtttgtcctgtaaaagatgttagtaagacaattgat
gaaataatcctcaatctccgtgctgcgggcaaaaagccctactttattgctggtggtgga
catggcaatattggaacgcaggcgtatgtagactgctataacgaaatttgtgattttgaa
aagaagaactctgttttctttgattacatcttttttgcctcaggcacaggaacgactcag
gctggacttgtatgcgggaagatgatgaatggcgataatcgccaaattattggaatcagt
attgcccgaaaaaatccaagaggcagaaatgtcgttgttgattcagtcaaggaatatctg
tcagctaaatcaatctcgtttacagataatcaaattgaagaaaatgttgtttttgtcgat
gattataccgttgatggctatggttgtcaaaatcaattagttcaggaaacgataaaaaac
gccttgttcaattatgggattcctatggattctacatatgtggcaaaagcttttgccgga
atgaatgattatttagtgttacgcaaaattaaatcgaaaaatgtgctgtttatccataca
ggcggaacccctttgtttttcgacagtttgaaggatatggagtag

DBGET integrated database retrieval system