KEGG   Fibrobacter succinogenes: FSU_3220Help
Entry
FSU_3220          CDS       T02105                                 

Definition
putative 1-aminocyclopropane-1-carboxylate deaminase
Organism
fsc  Fibrobacter succinogenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3732475..3733419
Genome map
AA seq 314 aa AA seqDB search
MSTESVLQTPIVNLDNYAGNHLWIKRDDLIPFSFGGNKARKAFGFFREFDAGNYDCIVTY
GSSSSNHCRVVSNMARQRNIPCYIIAPEEASKPTFNSQLMDLFGAEFKVCPVKDVSKTID
EIILNLRAAGKKPYFIAGGGHGNIGTQAYVDCYNEICDFEKKNSVFFDYIFFASGTGTTQ
AGLVCGKMMNGDNRQIIGISIARKNPRGRNVVVDSVKEYLSAKSISFTDNQIEENVVFVD
DYTVDGYGCQNQLVQETIKNALFNYGIPMDSTYVAKAFAGMNDYLVLRKIKSKNVLFIHT
GGTPLFFDSLKDME
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaagcgtacttcagactccaatagttaaccttgataattatgcaggtaat
catctatggattaagcgagatgatctgatacctttttcttttggtggaaataaggctcgc
aaggcattcggcttttttagggagtttgatgccggaaattacgattgcattgtgacttat
ggcagtagcagctcaaatcactgtcgggttgtatcgaatatggcgaggcaaagaaacatt
ccctgctatattatagcacctgaagaggcttccaaaccgacattcaatagtcaattgatg
gatttattcggtgctgaatttaaggtttgtcctgtaaaagatgttagtaagacaattgat
gaaataatcctcaatctccgtgctgcgggcaaaaagccctactttattgctggtggtgga
catggcaatattggaacgcaggcgtatgtagactgctataacgaaatttgtgattttgaa
aagaagaactctgttttctttgattacatcttttttgcctcaggcacaggaacgactcag
gctggacttgtatgcgggaagatgatgaatggcgataatcgccaaattattggaatcagt
attgcccgaaaaaatccaagaggcagaaatgtcgttgttgattcagtcaaggaatatctg
tcagctaaatcaatctcgtttacagataatcaaattgaagaaaatgttgtttttgtcgat
gattataccgttgatggctatggttgtcaaaatcaattagttcaggaaacgataaaaaac
gccttgttcaattatgggattcctatggattctacatatgtggcaaaagcttttgccgga
atgaatgattatttagtgttacgcaaaattaaatcgaaaaatgtgctgtttatccataca
ggcggaacccctttgtttttcgacagtttgaaggatatggagtag

DBGET integrated database retrieval system