KEGG   Flexistipes sinusarabici: Flexsi_0016Help
Entry
Flexsi_0016       CDS       T01539                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fsi  Flexistipes sinusarabici
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Flexsi_0016
Enzymes [BR:fsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Flexsi_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(19355..20509)
Genome map
AA seq 384 aa AA seqDB search
MKNIGIIGATGSIGIQAAEIIYKHSDVFNVKFLSCHNNVNELLNQISLLRPEYAVITGDK
TIPENLTETKILYGTHSLTTLISELSGELDIVLSAAVGFAGIMPTYTALKNGVDVALANK
ESIVAAGKTMIQTAEKANASIIPVDSEHSSIYQCLKGHDKNFIDKVILTASGGPFRYRPS
DSMDFVNINETLKHPNWSMGNKITVDSATMMNKGLELIEAHYLFNIVPEKLDVFVHPQSI
FHSIVSFIDGSNLAQIGLPDMKTPISYALGFPDRLDWGAEPLTPQILNGLKFFKPDKKKY
PCFAVALDVLKERKNSLMIAMNAANEVAVDTFLKGSIKFTDIHRVIINTLELFEPRDISS
IDEIVSLDNVVREKAMKISKDFGR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatatcggaataatcggggcaaccggctcaatcggcatccaggccgctgagatt
atttataagcacagtgatgtttttaatgtcaaatttttatcctgccacaacaatgtaaac
gaattattgaaccagatttcccttttgagacctgaatatgcagttattacaggagataaa
actattcctgagaacttaaccgagacaaaaattctgtatggcacacactccctgacaaca
ttaatttccgagttgtccggtgaactggatattgtattatccgctgctgttggttttgcc
ggcattatgccaacatacactgcgttaaaaaatggggtggatgttgcactcgccaacaaa
gagtctattgtagcagctggcaagacaatgattcagaccgcagaaaaagccaatgcctca
ataatacctgttgatagtgagcattcatcaatttatcagtgtttaaaaggtcacgataaa
aattttattgataaagtaatacttactgcaagcggaggcccatttagatatcgtccttct
gactcaatggattttgtaaatattaatgaaacattaaagcatcccaactggagtatgggc
aataagatcacggttgactctgctaccatgatgaataaaggccttgaacttattgaggcg
cattatctttttaatatagtaccggaaaaacttgatgttttcgtccacccacagagtata
tttcactcaattgtatcttttatagacggcagcaacctggcacagatagggctgcctgat
atgaaaacacctatttcctatgcacttggatttccagacagattggactggggggctgaa
ccgttaactccgcaaattttgaacggattgaaatttttcaaaccggataaaaagaaatac
ccttgttttgcagttgctttggacgttttaaaggaaaggaagaacagcctcatgattgca
atgaatgctgctaacgaagtagctgttgatactttcttaaaaggttcaattaagtttacc
gatatacatcgggtgataataaatacattagaactttttgaaccgcgggatatctcaagc
attgacgaaattgtttcattggataatgtagtcagagaaaaagcaatgaaaatatcaaaa
gattttggaaggtaa

DBGET integrated database retrieval system