KEGG   Flexistipes sinusarabici: Flexsi_0079Help
Entry
Flexsi_0079       CDS       T01539                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00260  Glycine, serine and threonine metabolism
fsi00750  Vitamin B6 metabolism
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01120  Microbial metabolism in diverse environments
fsi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Flexsi_0079
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Flexsi_0079
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Flexsi_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Cache_3-Cache_2
Motif
Other DBs
NCBI-ProteinID: AEI13775
UniProt: F8E6Y9
Position
complement(84710..86128)
Genome map
AA seq 472 aa AA seqDB search
MKYKSTRGGVQGISFKDAVMMGLAEDGGLLVPENLPAADIGYLHSCACKSYESLAFEIFK
LFADDIEEETLWEIVKESYANFDSGEIVPVVHKDRIYVAELFHGPTYAFKDIALQFLGNL
FEHILKERSEKMNILGATSGDTGSAAIYGVKGKDNINIFILHPSGKVSPVQELQMTTVKS
ENVFNIAVKGSFDDCQAIVKNLFSDLEFKSKYNLGAVNSINWARILAQIVYYFYIYFRIC
DEKSNGGKNLRFVVPTGNFGNILAGFYARRMGLPIDKLVLATNENNILHRMISYGDYSVK
DVVQTYSPSMDIQLSSNLERYLYYLYEEDSETLDKKMKELNDERRIHFTEEEINKIRSVF
LSQESSNEETLSTIRNFYNSTQYILDPHTACGVKAAENFMAKDNCIYVCLATAHPAKFPD
AVYKAIGKYPERPEGICKLNDLEKQSYVLNNNTDEVKYFIKNILEEGDKNAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagcacccgcggaggtgtgcaaggaatttcatttaaagatgctgttatg
atggggctcgctgaagacggcggtctccttgttcctgagaatttacctgcagctgacatc
ggttatctgcacagttgtgcatgtaagagttacgagagcctcgcttttgaaatattcaaa
ctctttgctgacgatatagaagaggaaactctctgggaaatcgttaaagaaagctatgcc
aattttgattccggagaaatagtaccggtggttcacaaagacaggatatatgtggcggaa
ctttttcacggccccacatatgctttcaaagatattgctctgcagtttctgggaaatctt
tttgagcatattttaaaagagcgcagcgaaaaaatgaatattctgggggccacaagcgga
gatacgggcagtgctgcgatttacggagttaaaggcaaagacaatataaatatttttatt
cttcaccccagcggaaaagttagtcctgtgcaggaacttcagatgaccacagtaaaaagt
gaaaacgtttttaacatagctgtaaagggctcttttgatgactgccaggctattgtaaaa
aatcttttttccgaccttgagtttaaatccaaatataatctgggtgcagttaattcaatt
aactgggcacgtatactggctcaaatagtctactacttttatatatattttcgcatttgt
gatgaaaaatcaaacggtggcaaaaacttacgtttcgttgtgcccacaggtaattttgga
aatattcttgcaggtttttacgcccgccggatgggtcttccaatcgataagctggtactg
gcaacaaatgaaaacaacatactgcacaggatgatcagttacggcgattacagcgtcaaa
gatgttgtacagacgtacagcccgtctatggatatacaactttccagtaatcttgaaagg
tatttatattacctttacgaagaagactccgaaaccctggataaaaaaatgaaagaactg
aatgatgaaagaagaatacattttacagaagaagagattaataaaatccgcagcgttttc
ctgtcccaggagtcttccaacgaagaaaccctaagcaccattagaaatttctataatagc
acacaatatatacttgatcctcatacagcgtgcggagtaaaagctgccgagaattttatg
gccaaggataactgtatttacgtctgccttgctactgctcatccggcaaagtttcccgac
gccgtctacaaagcaataggtaaataccccgaacgacccgaaggcatctgtaagctcaac
gaccttgaaaaacagtcatatgttcttaataataacactgatgaagtaaaatattttatt
aaaaacattctggaggaaggcgataaaaacgccggttga

DBGET integrated database retrieval system