KEGG   Flexistipes sinusarabici: Flexsi_0079Help
Entry
Flexsi_0079       CDS       T01539                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Flexsi_0079
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Flexsi_0079
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Flexsi_0079
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Flexsi_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(84710..86128)
Genome map
AA seq 472 aa AA seqDB search
MKYKSTRGGVQGISFKDAVMMGLAEDGGLLVPENLPAADIGYLHSCACKSYESLAFEIFK
LFADDIEEETLWEIVKESYANFDSGEIVPVVHKDRIYVAELFHGPTYAFKDIALQFLGNL
FEHILKERSEKMNILGATSGDTGSAAIYGVKGKDNINIFILHPSGKVSPVQELQMTTVKS
ENVFNIAVKGSFDDCQAIVKNLFSDLEFKSKYNLGAVNSINWARILAQIVYYFYIYFRIC
DEKSNGGKNLRFVVPTGNFGNILAGFYARRMGLPIDKLVLATNENNILHRMISYGDYSVK
DVVQTYSPSMDIQLSSNLERYLYYLYEEDSETLDKKMKELNDERRIHFTEEEINKIRSVF
LSQESSNEETLSTIRNFYNSTQYILDPHTACGVKAAENFMAKDNCIYVCLATAHPAKFPD
AVYKAIGKYPERPEGICKLNDLEKQSYVLNNNTDEVKYFIKNILEEGDKNAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagcacccgcggaggtgtgcaaggaatttcatttaaagatgctgttatg
atggggctcgctgaagacggcggtctccttgttcctgagaatttacctgcagctgacatc
ggttatctgcacagttgtgcatgtaagagttacgagagcctcgcttttgaaatattcaaa
ctctttgctgacgatatagaagaggaaactctctgggaaatcgttaaagaaagctatgcc
aattttgattccggagaaatagtaccggtggttcacaaagacaggatatatgtggcggaa
ctttttcacggccccacatatgctttcaaagatattgctctgcagtttctgggaaatctt
tttgagcatattttaaaagagcgcagcgaaaaaatgaatattctgggggccacaagcgga
gatacgggcagtgctgcgatttacggagttaaaggcaaagacaatataaatatttttatt
cttcaccccagcggaaaagttagtcctgtgcaggaacttcagatgaccacagtaaaaagt
gaaaacgtttttaacatagctgtaaagggctcttttgatgactgccaggctattgtaaaa
aatcttttttccgaccttgagtttaaatccaaatataatctgggtgcagttaattcaatt
aactgggcacgtatactggctcaaatagtctactacttttatatatattttcgcatttgt
gatgaaaaatcaaacggtggcaaaaacttacgtttcgttgtgcccacaggtaattttgga
aatattcttgcaggtttttacgcccgccggatgggtcttccaatcgataagctggtactg
gcaacaaatgaaaacaacatactgcacaggatgatcagttacggcgattacagcgtcaaa
gatgttgtacagacgtacagcccgtctatggatatacaactttccagtaatcttgaaagg
tatttatattacctttacgaagaagactccgaaaccctggataaaaaaatgaaagaactg
aatgatgaaagaagaatacattttacagaagaagagattaataaaatccgcagcgttttc
ctgtcccaggagtcttccaacgaagaaaccctaagcaccattagaaatttctataatagc
acacaatatatacttgatcctcatacagcgtgcggagtaaaagctgccgagaattttatg
gccaaggataactgtatttacgtctgccttgctactgctcatccggcaaagtttcccgac
gccgtctacaaagcaataggtaaataccccgaacgacccgaaggcatctgtaagctcaac
gaccttgaaaaacagtcatatgttcttaataataacactgatgaagtaaaatattttatt
aaaaacattctggaggaaggcgataaaaacgccggttga

DBGET integrated database retrieval system