KEGG   Flexistipes sinusarabici: Flexsi_0092Help
Entry
Flexsi_0092       CDS       T01539                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fsi  Flexistipes sinusarabici
Brite
Enzymes [BR:fsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Flexsi_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97868..98476)
Genome map
AA seq 202 aa AA seqDB search
MRNKVPESFIKNTIAPHCNNDPHIINAFRIIPRSRFMDDALARFAYDDNAQPIGFGQTIS
KPSTVALMTYLLAPEPSDKILEIGTGSGFQAAVLSRLVSSVYTVERIPRLYARASERIRR
LFIKNVFFKLTSNSAGWPDEAPFDKIIFTCGAQNIGEDYFRQLKVGGRIVAPIKDKITLF
KKTPEGIEKEENKECSFVEYIL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaggtacctgaaagttttataaaaaacactatcgctccgcactgtaacaat
gacccccatattataaatgcattcagaataataccgagaagccggtttatggacgatgct
cttgcaaggtttgcttatgatgataatgcacagcccataggttttgggcagaccatttca
aaaccgtcaaccgtggcactgatgacatatctgcttgctcctgaaccatctgataaaata
cttgagattggaacaggctccggctttcaggcggctgtactgtcacgccttgtatcatct
gtctacacagttgagcgaatcccccgtctttatgcaagagcttccgaaaggatacgacgt
cttttcattaaaaatgtattttttaaattaacatctaattcagccggatggcctgatgag
gctccttttgacaaaattatttttacctgcggtgcccaaaatattggtgaggattacttc
agacagttaaaagttggcggcagaatcgtggcacctataaaagataaaatcacactgttt
aaaaagacccctgaggggatagagaaagaggaaaacaaggaatgcagttttgtagaatat
atcctctga

DBGET integrated database retrieval system