KEGG   Flexistipes sinusarabici: Flexsi_0105Help
Entry
Flexsi_0105       CDS       T01539                                 

Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
fsi  Flexistipes sinusarabici
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fsi00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fsi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(109274..109885)
Genome map
AA seq 203 aa AA seqDB search
MKNIAVLLSGRGSNFKAIYSSIEAGYIADARITTVVSNKAEAPGLQFAKDRGLNSYFVNP
SEYGSRTAYDTVIIDILKSRKTDLVCLAGYMKLLSAKFVDTFKNRIMNIHPSLLPSFPGL
NAQKQALDYGVKISGCTVHFVDKELDHGPIILQKAVEIKENDTVNDLSERILKEEHKIYP
EAVRLFVENRLTLHNRKVNIDYS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatattgcagttcttttgagcggccggggcagcaatttcaaggctatatacagc
tcaattgaagccggttatatagcagatgcaaggataacgaccgttgtcagtaacaaagct
gaagcccccggtttacagtttgccaaggacaggggtttaaactcttattttgtaaatcct
tcagaatatggcagtagaacggcctatgatacagtaattatcgatatcctgaaatcccgg
aaaacagatctggtatgcctggccggttacatgaagctcctttcggcaaaatttgtagac
acatttaaaaacagaattatgaatatccacccttcccttctgccctcttttcccggctta
aacgcacaaaagcaggcgttggactacggggttaagatttccggctgcactgttcatttt
gtggacaaagaattggatcacggccccataattctccaaaaagctgttgaaataaaggaa
aacgataccgtaaacgatctctctgaaagaattttgaaagaagagcataaaatctatccg
gaggcagtccggctctttgttgaaaaccgactgactttacataacagaaaagtcaatatc
gactacagttga

DBGET integrated database retrieval system