KEGG   Flexistipes sinusarabici: Flexsi_0292Help
Entry
Flexsi_0292       CDS       T01539                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
fsi  Flexistipes sinusarabici
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fsi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(312113..312712)
Genome map
AA seq 199 aa AA seqDB search
MLKIKSFDKCVFELGKLPGIGRKTALRLAMYIMKMNERDVKELADSIVDLKQNIKFCKEC
GGLSDGELCSICADSYRDKRVVCVVEEPKDIFIIESSGRYKGVYHVLGGKIAPLDGIGPD
ELNLQRLIDLACENKVDEVIIATNPDIEGETTATYVYKLLKDFDVKMTRIASGVPTGGLL
EFSDDITILKAIENRREMY
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatcaagagttttgacaaatgcgttttcgaattgggcaagctgcccggtatc
ggacgaaaaacagcactgagacttgccatgtatatcatgaaaatgaatgagagggatgtc
aaagagcttgcagacagtattgtcgatttgaagcagaatataaagttctgcaaagagtgc
ggaggattgtccgatggcgaattatgcagtatctgcgcagactcatacagggataaaaga
gtagtctgtgttgtggaggagcccaaagatatatttattatcgaatccagcggaaggtat
aaaggtgtgtatcatgtccttggcggcaaaattgcaccgctggacgggataggtcctgat
gagctgaatcttcagagacttatcgacttggcttgtgaaaacaaggttgatgaagttatc
attgccacaaaccctgatattgaaggagaaaccaccgcaacttatgtgtataaactgcta
aaagacttcgatgttaaaatgacaaggatagccagtggtgtccccaccggcggattgctg
gaattttctgatgatatcaccatattaaaagctattgagaacagaagggaaatgtattaa

DBGET integrated database retrieval system