KEGG   Flexistipes sinusarabici: Flexsi_0309Help
Entry
Flexsi_0309       CDS       T01539                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fsi  Flexistipes sinusarabici
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:fsi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328355..329194
Genome map
AA seq 279 aa AA seqDB search
MSTYLPVSGWCYMTNDLMKEIIRVAVEAGERIMKIYEGDIRIEHKEDSSPLTEADRRSHE
HIVSELKKITPEIPVLSEESADISWQKRKSWGKYWLVDPLDGTKEFIKKNGEFTVNIALI
KENALAAGVVVIPAQKLIYRADINNGAFRRNYDGAETKLTADNNLNTDNLKIVGSRSHQS
ELMQTFVSNFENYEIVAAGSSLKFCLLAEGKADVYPRFGPTSEWDTAAGQCVLECAGGVV
LDNAGNKLQYNTKDSVLNPYFIGMREYNEAVLSWFKALN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacatatttaccagtctccggctggtgctatatgacaaatgatttaatgaaagaa
attatccgggttgcagttgaagccggagagagaattatgaaaatttatgaaggtgatatc
cggattgagcacaaggaggattccagccctcttactgaggctgacaggcgctctcacgaa
catattgtctcagagcttaaaaagataacacctgaaattccggttttatctgaggaatct
gcggatatcagctggcaaaagagaaaaagctggggtaaatactggcttgtggatcctttg
gacggcactaaagaatttataaaaaagaacggtgaatttaccgtaaatattgctttgata
aaagaaaacgccctcgctgcgggcgttgtggtcattcctgctcaaaaactaatctaccgg
gctgatataaataacggagcttttagaagaaattatgacggggctgaaacaaagctgacg
gctgataataatctaaatacagataatctaaaaatcgttggcagcaggtcacatcagagt
gagctaatgcagacatttgtttcaaattttgaaaattatgagattgtagcagcagggagc
tctctgaaattctgtctcttagccgaaggcaaagccgatgtttacccgagattcggtccc
acatctgaatgggatacagcagccgggcagtgtgtgctggaatgtgccggcggagttgta
ctcgataatgctggcaacaaacttcaatacaatacaaaagattccgtgctaaatccttat
tttatcggaatgagagaatacaatgaagctgttttaagctggtttaaggcgttaaattaa

DBGET integrated database retrieval system