KEGG   Flexistipes sinusarabici: Flexsi_0432Help
Entry
Flexsi_0432       CDS       T01539                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fsi  Flexistipes sinusarabici
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Flexsi_0432
Enzymes [BR:fsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Flexsi_0432
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Flexsi_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453380..454177
Genome map
AA seq 265 aa AA seqDB search
MPELPDVTYFKHYIDRVALHKKISAVQCDDERVLKNTNCQGLNRILKGEKFAGTKRRGKF
LIINLANSGKMLILHFGMTGNISYRESEAKTEDEKKYSQLTIEFHNGSRLFWINKRLLGS
VHLVDKVDEVATIKEMGPDALELSENLFLKLLSKHERKNIKAFLMDQSNIAGLGNEYSNE
LLFQADIDPHRKIKGLGNPERKNIYKVMRDMLEKAIEIGVPVNPFPDDWLLAHMDDMTCP
KDVKHNLKKERIAGRTAVYCPVHQV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttcctgatgtaacctatttcaagcattatattgaccgagttgcgctccat
aaaaaaatatcagctgttcaatgcgacgatgagcgtgtcttgaaaaatacgaattgtcag
gggttgaatcgcatactcaaaggagagaagtttgcaggaacaaaaaggcgtggtaagttt
ttgataataaatctcgccaactccggtaaaatgctgattttacacttcggtatgaccggt
aatatttcttaccgtgagagtgaagccaagacggaggatgaaaaaaaatattctcaattg
acaattgaatttcataacggatcgcgtttgttctggattaacaaacgtcttttgggttcc
gtacatttggtggacaaggttgatgaagttgcaacgattaaggaaatgggaccggacgca
ttggagctttccgaaaatttatttttgaaacttttgtcaaaacacgagcggaagaatatt
aaagcatttttaatggatcagtcaaatatagccggcctgggaaacgagtattctaatgaa
ttgttatttcaggcggatatcgatccgcacagaaagattaaaggtttaggtaaccctgag
cggaagaatatttataaagtgatgcgtgatatgcttgagaaagcaattgagatcggtgtg
ccggttaatccgtttccggatgactggcttttggcgcatatggatgatatgacatgccct
aaagacgtaaagcataatttgaaaaaagaaagaattgcgggacgcacggcagtttattgt
ccggtacatcaagtgtag

DBGET integrated database retrieval system