KEGG   Flexistipes sinusarabici: Flexsi_0447Help
Entry
Flexsi_0447       CDS       T01539                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00340  Histidine metabolism
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Flexsi_0447
Enzymes [BR:fsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Flexsi_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEI14134
UniProt: F8E910
Position
473646..474911
Genome map
AA seq 421 aa AA seqDB search
MIIDKNSDKLNKILNRGELFDEKYLSVVMDILKDVRINGDKAVKSYTKKFDNHDLNESYV
IGVDELKSSFDKLESGLKDSLIKAEKSIRFYHEKQMEKTWLINGNNGIVLGQKISPVENV
GIYVPGGKAVYPSSVLMNSVPANVAGVENIVMSTPAAYGKVQESVLAAAYLGGVKKVYKI
GGAQAVAAMAYGTETVEKVDKIVGPGNIFVALAKKLVFGFVDIDMIAGPSEITIIADESA
NPQFIAADMLSQAEHDEMASSVLITYSKKLAESVNAELKKQLEELPRKDIAEASLKDFGA
IVLVENLEEAAEVSDRIAPEHLELCVANPYELMFKVRNAGAIFLGHYTPEAVGDYIAGPN
HTLPTGGSARFFSPLGAYDFLKRSSIVNFTKDALRECAEDVMGIANSEELTAHAKSVKIR
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgataattgacaagaacagcgataaacttaacaaaattcttaacaggggagaacttttc
gacgagaaatatttgtccgtagtgatggatatcctgaaggatgtaagaatcaacggcgat
aaagctgtaaaatcgtatacaaagaagtttgataatcatgatttgaatgaaagctatgtg
attggcgtggatgagctgaagtcatcttttgataaactggagagcggattaaaagattca
ctgataaaggctgaaaagtccatccgtttttatcatgaaaaacagatggagaagacgtgg
cttattaacgggaataacgggatcgttctcggtcagaaaatcagccctgttgaaaatgtc
gggatatatgttcccggcggcaaagcggtttatccctcgtcagttttgatgaacagtgtc
ccggcaaatgttgcaggtgtggaaaacattgtaatgtcaactcctgctgcatacggcaaa
gttcaggaaagtgttttggctgcggcgtatctcggtggagttaaaaaggtgtataaaatt
ggcggtgctcaggctgtggcagccatggcatatggaactgaaacggttgaaaaagtggat
aaaattgtaggacctggtaatatatttgttgctttggctaaaaagcttgttttcggcttt
gtggatattgatatgattgccggtccgagtgagataacaataatcgccgatgaatctgcc
aatcctcaatttattgctgcggacatgctcagtcaggccgaacacgatgagatggcttca
tctgttttaattacctattcaaaaaagttggctgaaagtgtaaatgctgaattgaaaaaa
cagttggaagaattgccgagaaaagatatagcggaggcttctttaaaggattttggtgcc
attgtgttggttgaaaaccttgaagaggcagcagaggtttctgataggattgcacctgaa
catttggaattgtgcgtggcaaacccttacgaactgatgtttaaagtgcggaatgccgga
gcaattttcctggggcattatacacctgaagctgtcggggattatattgccgggcctaat
catactctgccaaccggaggttcggctcgttttttttcacctttgggagcatatgatttt
cttaaaagaagcagtattgtaaattttaccaaggatgctttaagagaatgcgctgaagat
gttatgggaattgcaaacagtgaagaactaacagctcatgccaagtctgtgaaaatccgc
atttaa

DBGET integrated database retrieval system