KEGG   Flexistipes sinusarabici: Flexsi_0447Help
Entry
Flexsi_0447       CDS       T01539                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fsi  Flexistipes sinusarabici
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Flexsi_0447
  Amino acid metabolism
   00340 Histidine metabolism
    Flexsi_0447
Enzymes [BR:fsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Flexsi_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473646..474911
Genome map
AA seq 421 aa AA seqDB search
MIIDKNSDKLNKILNRGELFDEKYLSVVMDILKDVRINGDKAVKSYTKKFDNHDLNESYV
IGVDELKSSFDKLESGLKDSLIKAEKSIRFYHEKQMEKTWLINGNNGIVLGQKISPVENV
GIYVPGGKAVYPSSVLMNSVPANVAGVENIVMSTPAAYGKVQESVLAAAYLGGVKKVYKI
GGAQAVAAMAYGTETVEKVDKIVGPGNIFVALAKKLVFGFVDIDMIAGPSEITIIADESA
NPQFIAADMLSQAEHDEMASSVLITYSKKLAESVNAELKKQLEELPRKDIAEASLKDFGA
IVLVENLEEAAEVSDRIAPEHLELCVANPYELMFKVRNAGAIFLGHYTPEAVGDYIAGPN
HTLPTGGSARFFSPLGAYDFLKRSSIVNFTKDALRECAEDVMGIANSEELTAHAKSVKIR
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgataattgacaagaacagcgataaacttaacaaaattcttaacaggggagaacttttc
gacgagaaatatttgtccgtagtgatggatatcctgaaggatgtaagaatcaacggcgat
aaagctgtaaaatcgtatacaaagaagtttgataatcatgatttgaatgaaagctatgtg
attggcgtggatgagctgaagtcatcttttgataaactggagagcggattaaaagattca
ctgataaaggctgaaaagtccatccgtttttatcatgaaaaacagatggagaagacgtgg
cttattaacgggaataacgggatcgttctcggtcagaaaatcagccctgttgaaaatgtc
gggatatatgttcccggcggcaaagcggtttatccctcgtcagttttgatgaacagtgtc
ccggcaaatgttgcaggtgtggaaaacattgtaatgtcaactcctgctgcatacggcaaa
gttcaggaaagtgttttggctgcggcgtatctcggtggagttaaaaaggtgtataaaatt
ggcggtgctcaggctgtggcagccatggcatatggaactgaaacggttgaaaaagtggat
aaaattgtaggacctggtaatatatttgttgctttggctaaaaagcttgttttcggcttt
gtggatattgatatgattgccggtccgagtgagataacaataatcgccgatgaatctgcc
aatcctcaatttattgctgcggacatgctcagtcaggccgaacacgatgagatggcttca
tctgttttaattacctattcaaaaaagttggctgaaagtgtaaatgctgaattgaaaaaa
cagttggaagaattgccgagaaaagatatagcggaggcttctttaaaggattttggtgcc
attgtgttggttgaaaaccttgaagaggcagcagaggtttctgataggattgcacctgaa
catttggaattgtgcgtggcaaacccttacgaactgatgtttaaagtgcggaatgccgga
gcaattttcctggggcattatacacctgaagctgtcggggattatattgccgggcctaat
catactctgccaaccggaggttcggctcgttttttttcacctttgggagcatatgatttt
cttaaaagaagcagtattgtaaattttaccaaggatgctttaagagaatgcgctgaagat
gttatgggaattgcaaacagtgaagaactaacagctcatgccaagtctgtgaaaatccgc
atttaa

DBGET integrated database retrieval system