KEGG   Flexistipes sinusarabici: Flexsi_0495Help
Entry
Flexsi_0495       CDS       T01539                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00051  Fructose and mannose metabolism
fsi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Flexsi_0495
Enzymes [BR:fsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Flexsi_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEI14182
UniProt: F8E9D0
Position
509889..510443
Genome map
AA seq 184 aa AA seqDB search
MRIEDQFVFYGKKCVKEGMTTSFFGNISFLQGDLLYITASGAMLDDLGRNDILQLNIKKE
SPAEKRASSELCVHRKIYERTSFKSVIHTHSLYTVILSKYKSQLSFQLSEVLPFLENIPV
VEGRSGSMQLAENVATAAEKSTLVVVKEHGVFAQAPSLKEAYVRISALEYISKKTVLEQI
YYRG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagaagatcagtttgttttttatggcaaaaaatgtgtaaaagaggggatgaca
acctcattcttcggtaatatttcttttttgcagggtgatctgttgtatattactgcatca
ggagctatgcttgatgatctgggacgaaatgatattttgcagcttaatattaaaaaggaa
tctcctgctgagaaacgtgcttcatctgaattgtgtgttcatcgtaaaatatatgaaaga
acatcttttaaaagcgtaatacacacccacagcttatatacagttattctttcaaagtat
aaatcacaactttcatttcagctttccgaagtgttgccttttctggagaacataccggtt
gttgaaggcagaagcggcagtatgcagctggctgaaaatgtggcgactgccgccgaaaaa
agtacccttgtggtggtgaaggaacatggtgtgtttgcccaggctccatcattaaaagaa
gcctatgtcagaatttctgctttggaatatatcagcaaaaagaccgtccttgaacagata
tattatcggggatga

DBGET integrated database retrieval system