KEGG   Flexistipes sinusarabici: Flexsi_0495Help
Entry
Flexsi_0495       CDS       T01539                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fsi  Flexistipes sinusarabici
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fsi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
509889..510443
Genome map
AA seq 184 aa AA seqDB search
MRIEDQFVFYGKKCVKEGMTTSFFGNISFLQGDLLYITASGAMLDDLGRNDILQLNIKKE
SPAEKRASSELCVHRKIYERTSFKSVIHTHSLYTVILSKYKSQLSFQLSEVLPFLENIPV
VEGRSGSMQLAENVATAAEKSTLVVVKEHGVFAQAPSLKEAYVRISALEYISKKTVLEQI
YYRG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagaagatcagtttgttttttatggcaaaaaatgtgtaaaagaggggatgaca
acctcattcttcggtaatatttcttttttgcagggtgatctgttgtatattactgcatca
ggagctatgcttgatgatctgggacgaaatgatattttgcagcttaatattaaaaaggaa
tctcctgctgagaaacgtgcttcatctgaattgtgtgttcatcgtaaaatatatgaaaga
acatcttttaaaagcgtaatacacacccacagcttatatacagttattctttcaaagtat
aaatcacaactttcatttcagctttccgaagtgttgccttttctggagaacataccggtt
gttgaaggcagaagcggcagtatgcagctggctgaaaatgtggcgactgccgccgaaaaa
agtacccttgtggtggtgaaggaacatggtgtgtttgcccaggctccatcattaaaagaa
gcctatgtcagaatttctgctttggaatatatcagcaaaaagaccgtccttgaacagata
tattatcggggatga

DBGET integrated database retrieval system