KEGG   Flexistipes sinusarabici: Flexsi_0660Help
Entry
Flexsi_0660       CDS       T01539                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fsi  Flexistipes sinusarabici
Brite
Enzymes [BR:fsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Flexsi_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_18 Methyltransf_25 GidB tRNA_U5-meth_tr CMAS Methyltransf_11 MTS Methyltransf_23 PrmA FAD_binding_5 ACP_syn_III_C DOT1 Methyltransf_32 Met_10 Methyltr_RsmB-F DUF938 DREV Methyltransf_PK Methyltransf_16 NodS
Motif
Other DBs
NCBI-ProteinID: AEI14336
UniProt: F8E3R3
Position
complement(675496..676125)
Genome map
AA seq 209 aa AA seqDB search
MNSAEADLKIERMIQTQMINRDIRDPRVIGVFRKVKRHLFVRPKDIDYAYEDTPLSIGFG
QTISQPYMVAKITETAQIEDNDKVLEIGAGSGYQAAIAAQLCKKVYTVEVIKKLAEFAEN
NLNKSGINNVEVITKSGFHGYSEQSPYDRIILSAAAKQIPVKLFEQLKENGIMVAPVGTY
PQTLFRFTKQNGEIIKEHFLNCVFVPLVR
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgcagaggctgatttaaaaatagaacgaatgatacaaacacagatgataaac
cgggatatcagagacccccgggttattggcgtttttagaaaagtaaaaaggcatcttttt
gtgcgcccgaaagacatcgattatgcctatgaggatactcctctttcgataggattcggc
caaacaatttcccagccgtatatggttgcaaaaataacggaaacagctcaaatagaagac
aatgacaaagtacttgaaatcggagcaggctccggctatcaggccgcaatagcagcacag
ctatgtaaaaaagtttacactgtggaagtgataaaaaagcttgcagaatttgctgaaaat
aatcttaataaatcgggtataaacaacgttgaagtcattaccaaaagcggctttcacggt
tattcggaacagtccccctatgacagaattatcctttctgctgctgcaaaacaaattcct
gtaaaattgttcgaacaactgaaggaaaacggaataatggttgcaccagttggcacttat
cctcaaacgcttttccgttttaccaaacaaaacggagaaatcattaaagagcatttctta
aactgtgtttttgttcctttagtcagataa

DBGET integrated database retrieval system