KEGG   Flexistipes sinusarabici: Flexsi_0689Help
Entry
Flexsi_0689       CDS       T01539                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00020  Citrate cycle (TCA cycle)
fsi00640  Propanoate metabolism
fsi00660  C5-Branched dibasic acid metabolism
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01120  Microbial metabolism in diverse environments
fsi01130  Biosynthesis of antibiotics
fsi01200  Carbon metabolism
Module
fsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Flexsi_0689
   00640 Propanoate metabolism
    Flexsi_0689
   00660 C5-Branched dibasic acid metabolism
    Flexsi_0689
Enzymes [BR:fsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Flexsi_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEI14364
UniProt: F8E411
Position
711429..712604
Genome map
AA seq 391 aa AA seqDB search
MDIHEHQAKEIFRKYGVPTPNGYVVYKPDNAVKVAQQLGGDLDVWVVKAQIHAGGRGKAG
GVKLAKSTEEVGLLAKEMLGSTLVTHQTGANGKKVNRIYIEEGVNIEKEFYLGMVLDRSK
EMPVMMASSEGGIDIEEVADKSPEKIVKVAINPTIGFRGFYGRKLAFGLGLPREQVNKLI
KFAESIYNVYMDYDASLIEINPLVLTKDKTFIALDAKMSFDDNSLYRQPEILTMRDLTEE
EPVEVEANKHGLSYVKLDGNVGCMVNGAGLAMSTMDIIKHEGGTPANFLDVGGGANAETV
AKGFEIILSDPNVKSIFVNIFGGIVRCDRVAQGILEAAKITNVNVPVVVRLDGTNAEEAQ
EILANSGIKNIIAADSIADGARKAISAVRGN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatattcatgaacatcaggcaaaggaaattttcaggaaatacggtgtacccacaccg
aatgggtacgttgtttacaagccggataatgccgtaaaggtagcccagcagctgggaggg
gaccttgatgtatgggttgtgaaagcccaaattcatgccggcggcagagggaaagccgga
ggagttaagttagccaaatccacggaagaggttgggctgcttgcaaaagagatgctcgga
agcacacttgttacgcatcagacaggtgcgaacggaaagaaagttaacaggatttatata
gaagaaggcgtaaacattgaaaaggaattttatctgggtatggttcttgacagatctaaa
gaaatgccggttatgatggcttcttccgagggtggaatagatatcgaagaagttgctgat
aaatctcctgaaaaaatagtcaaagtggctattaaccctaccattggattcagaggtttt
tacggaaggaagcttgcttttggattaggtctgccaagagaacaggtaaataagttaata
aagtttgctgaatccatatacaatgtatatatggactatgatgccagtttaatagagatt
aacccccttgtcctgacaaaagataaaacgttcattgcattagatgccaagatgagtttt
gatgataactctctctacagacagccggaaattttgacaatgagggatttgacagaagaa
gaacccgttgaggttgaggcaaacaagcacggattgagctatgttaaacttgacggtaat
gtagggtgcatggtgaatggagccggtcttgctatgtctaccatggatataattaagcat
gaaggcggcacccctgctaactttttagatgtcggcggcggagccaatgctgaaacagta
gcaaaaggttttgaaattattctcagtgaccctaatgtgaaatctatttttgttaatatt
ttcggtggaattgtacgatgtgacagagttgctcagggtattcttgaagcagctaagatt
accaatgttaatgttcctgttgttgtcaggctggacggaacaaatgctgaagaggctcag
gaaatacttgcaaattccggtataaagaatattattgctgctgattcgattgccgatggt
gcaagaaaagctatcagcgctgtcagggggaattaa

DBGET integrated database retrieval system