KEGG   Flexistipes sinusarabici: Flexsi_0689Help
Entry
Flexsi_0689       CDS       T01539                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fsi  Flexistipes sinusarabici
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Flexsi_0689
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Flexsi_0689
   00640 Propanoate metabolism
    Flexsi_0689
   00660 C5-Branched dibasic acid metabolism
    Flexsi_0689
Enzymes [BR:fsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Flexsi_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711429..712604
Genome map
AA seq 391 aa AA seqDB search
MDIHEHQAKEIFRKYGVPTPNGYVVYKPDNAVKVAQQLGGDLDVWVVKAQIHAGGRGKAG
GVKLAKSTEEVGLLAKEMLGSTLVTHQTGANGKKVNRIYIEEGVNIEKEFYLGMVLDRSK
EMPVMMASSEGGIDIEEVADKSPEKIVKVAINPTIGFRGFYGRKLAFGLGLPREQVNKLI
KFAESIYNVYMDYDASLIEINPLVLTKDKTFIALDAKMSFDDNSLYRQPEILTMRDLTEE
EPVEVEANKHGLSYVKLDGNVGCMVNGAGLAMSTMDIIKHEGGTPANFLDVGGGANAETV
AKGFEIILSDPNVKSIFVNIFGGIVRCDRVAQGILEAAKITNVNVPVVVRLDGTNAEEAQ
EILANSGIKNIIAADSIADGARKAISAVRGN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatattcatgaacatcaggcaaaggaaattttcaggaaatacggtgtacccacaccg
aatgggtacgttgtttacaagccggataatgccgtaaaggtagcccagcagctgggaggg
gaccttgatgtatgggttgtgaaagcccaaattcatgccggcggcagagggaaagccgga
ggagttaagttagccaaatccacggaagaggttgggctgcttgcaaaagagatgctcgga
agcacacttgttacgcatcagacaggtgcgaacggaaagaaagttaacaggatttatata
gaagaaggcgtaaacattgaaaaggaattttatctgggtatggttcttgacagatctaaa
gaaatgccggttatgatggcttcttccgagggtggaatagatatcgaagaagttgctgat
aaatctcctgaaaaaatagtcaaagtggctattaaccctaccattggattcagaggtttt
tacggaaggaagcttgcttttggattaggtctgccaagagaacaggtaaataagttaata
aagtttgctgaatccatatacaatgtatatatggactatgatgccagtttaatagagatt
aacccccttgtcctgacaaaagataaaacgttcattgcattagatgccaagatgagtttt
gatgataactctctctacagacagccggaaattttgacaatgagggatttgacagaagaa
gaacccgttgaggttgaggcaaacaagcacggattgagctatgttaaacttgacggtaat
gtagggtgcatggtgaatggagccggtcttgctatgtctaccatggatataattaagcat
gaaggcggcacccctgctaactttttagatgtcggcggcggagccaatgctgaaacagta
gcaaaaggttttgaaattattctcagtgaccctaatgtgaaatctatttttgttaatatt
ttcggtggaattgtacgatgtgacagagttgctcagggtattcttgaagcagctaagatt
accaatgttaatgttcctgttgttgtcaggctggacggaacaaatgctgaagaggctcag
gaaatacttgcaaattccggtataaagaatattattgctgctgattcgattgccgatggt
gcaagaaaagctatcagcgctgtcagggggaattaa

DBGET integrated database retrieval system