KEGG   Flexistipes sinusarabici: Flexsi_0885Help
Entry
Flexsi_0885       CDS       T01539                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fsi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fsi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fsi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:fsi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:fsi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938629..940509
Genome map
AA seq 626 aa AA seqDB search
MLNKKLTDVNKNYKRANYSSEEIKKFYKEAESNLTFFNKISLELLTWDKKFDKVLDESEA
PFYKWFSGGLLNPFYNILTKHLHSATKNKAAIIWKGSDHTEKIYTYQSLYSETMKFASAL
KKLGVNKGDKVFIYMPNIPELIISMLACVRLGAVHVVYHHSYSSESFAERLDDCKPNYII
CCNVSYTGAEREIKKKVDASIEKASYSPKHCIVVQRSEKKVHMKPLRDLWYHDLISDEDF
TAAKNLDSVYYDSADPLFMTYTSTNLKEPKGLVFNCAGYLLWVYFSYLLIFDPNDLDTYW
STADISWIPGHSYGAYGPLMAGQSILIFEDTLDMNNAYRFYDICEKFQVTKFYTTPTILK
SIMNAAQKRSIYRKLSSIELIATGGERTSDELLEWVFKKILFQKKPIVNIYSLTEAGGAL
AANIPGYSEIDFSNVSKPLPGIDVFIYDELDESKINAQGRKGSLMLSKLTPSICKNICNG
SELYRSIYWRKVDSDFLFKTGDGAEFTENYEIVLTGRMDEVMHIGGKRVSFTEIEAAIKK
HPLVIDAAVININDEKRGDMLVAFCVLSRKIEESYYDQTVREIRETIISEIGEIVLPAEI
KFTRALPKSADGSILRDMLKEIATQM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcttaataaaaaactaaccgatgtgaataaaaactataaaagagccaactattccagc
gaagagataaagaaattttataaagaagccgaaagtaatttaactttttttaataaaata
tcacttgaacttttaacatgggataaaaagtttgataaagttctggatgaatcagaggct
cctttttacaaatggttcagcggcgggcttctcaaccctttttacaatattttaacaaaa
catcttcattcggccacaaaaaataaggcggccataatctggaaaggcagcgaccatacc
gaaaaaatttatacctatcagtctttatattctgaaaccatgaaatttgcttcggctttg
aagaaactgggtgttaataaaggtgataaggtttttatttatatgccgaatataccggag
cttattataagcatgcttgcctgtgtacgcttgggtgctgttcatgttgtttaccatcac
agctattcatccgagtcgtttgcggaaaggctggatgactgtaagccgaattacattatt
tgctgcaatgtgagctataccggtgcagaaagggaaatcaaaaagaaggtggacgcttca
atcgaaaaagcttcctatagccctaaacactgtattgttgttcagcggagtgaaaagaag
gtccatatgaaaccgttaagggacctgtggtatcacgatttgataagtgatgaggacttc
acagcagccaagaatctggacagcgtttattacgattcagccgatccgctttttatgaca
tacacatccacgaacctaaaagagccgaaagggcttgtgtttaactgtgccggttattta
ctctgggtgtacttcagttatctgttgatttttgatcccaatgatctggacacttactgg
agcacagctgatatttcctggattccgggtcactcttacggggcatacggcccccttatg
gccggtcagagtattcttatttttgaagacactctggatatgaacaatgcttaccgcttt
tatgacatatgcgaaaagtttcaggttacaaaattttataccactccaactatcctaaaa
tcaattatgaatgccgcccaaaaaagaagtatttacaggaaactcagcagcatagagctt
atagccaccggtggggaaagaacttccgatgagctattggaatgggtatttaaaaagata
ctttttcaaaaaaaaccgattgtcaatatttactcgctgacggaagccggaggggctctt
gcagcaaatatacccgggtattcggagattgatttttccaatgtttcaaagccgctgccg
ggtatagatgtattcatctatgatgaactggatgaaagcaaaattaacgctcagggcagg
aagggttcattgatgctgagtaagcttactccgtctatctgtaaaaatatctgcaatggc
agtgaattgtacagaagtatatactggaggaaagtggacagtgattttctctttaaaaca
ggagacggagcggaattcactgaaaattatgagatagttttaaccggtagaatggatgag
gttatgcatatagggggtaaacgggtaagttttactgaaattgaagcagctataaagaaa
catcctttggtgattgatgctgcagttattaatattaatgatgaaaaaagaggggatatg
cttgttgcattctgtgtgctttcaagaaaaattgaggaaagttattacgatcagacagtc
agggaaatcagggaaacaataatttctgaaatcggggagattgtgttaccggctgaaatt
aaatttacaagggctcttcccaaatctgccgacggatctatattgagagacatgcttaag
gagattgccacacagatgtaa

DBGET integrated database retrieval system