KEGG   Flexistipes sinusarabici: Flexsi_0970Help
Entry
Flexsi_0970       CDS       T01539                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fsi  Flexistipes sinusarabici
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Flexsi_0970
Enzymes [BR:fsi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Flexsi_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1037114..1038310
Genome map
AA seq 398 aa AA seqDB search
MSRFLQLISNDAERLKYEFKRIGVDEYAFKMAGKGKSLNIKVKDLIPAQANIIKQESLAA
GMDAAVSRGTVGCNVNKTDLLLMGNTIQYKRLIDRLKVQPYSLKLFAEELFNFLDKKKNR
MLVTPSGELALDEPEIMGILNVTPDSFSDGGDYFLHTDYRRRIDEIKDAGVKVIDIGGES
SRPGSTPVDAETEKERIAGAVEYALSSGLKVSVDTYKSAVAKDVLEKGADIINDISGFKF
DRDMPKVCADYGAAVCLMHTSSTPDKMQQKTDYANFLEEVKAYLFDSAEMALKAGIKEES
IILDPGFGFGKKLNDNYLLLKYLDEFKSTGMPIMIGVSRKSMINRVVDKPPGETALASKI
AETIALVQGADIVRTHDISETLDMVKIIREYRKADPDG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggttcctccaactgatcagtaatgatgctgaacggttaaaatatgaatttaag
cgtataggtgtggatgaatacgcctttaaaatggcaggaaaggggaaatctctgaatata
aaagtcaaggatctcattcccgcccaggccaatattatcaagcaggaatcgctggctgca
ggtatggatgctgctgtcagcaggggaaccgttggttgtaatgtaaacaaaactgatctt
cttttgatgggtaacacaatacagtataagcgtttgattgacagacttaaagttcaaccg
tattctttaaagttatttgctgaagaactgtttaactttttggacaagaagaaaaatagg
atgttggttactccatcaggtgagttggctctcgatgagcctgagattatgggaatcctt
aatgttacccctgactcattcagtgacggcggtgattattttttgcataccgactatagg
cgccgtatagatgaaataaaagacgccggtgttaaggttatcgatattgggggagaatca
tcccgaccgggttcgacccctgtggatgcggaaacggaaaaagagaggattgccggtgct
gttgaatatgctttgagcagcgggttaaaggtatctgttgatacgtataaatcggcagtt
gccaaagatgtgttggaaaaaggcgcagatataattaacgatatcagcggtttcaaattt
gaccgggatatgccgaaagtgtgtgcggattatggtgcagccgtgtgccttatgcataca
agcagtacacctgataaaatgcagcaaaaaacggattatgcgaattttctggaagaagta
aaagcctatttgtttgactctgcagaaatggctctaaaagccgggataaaggaagaaagt
ataatcttggatccagggttcggatttggcaagaaacttaatgataattatcttttgttg
aaatatcttgatgagtttaaatctacgggaatgccgataatgattggtgtttcccgaaaa
tctatgataaacagggttgtggataaacctcccggtgaaactgcactggcatcaaaaatt
gctgaaaccattgctttggttcagggtgcagatattgtgagaacccatgacatatcggaa
actttggatatggttaaaataatacgtgaatacaggaaggcagatcctgatggttga

DBGET integrated database retrieval system