KEGG   Flexistipes sinusarabici: Flexsi_1085Help
Entry
Flexsi_1085       CDS       T01539                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00010  Glycolysis / Gluconeogenesis
fsi00030  Pentose phosphate pathway
fsi00051  Fructose and mannose metabolism
fsi00052  Galactose metabolism
fsi00680  Methane metabolism
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01120  Microbial metabolism in diverse environments
fsi01130  Biosynthesis of antibiotics
fsi01200  Carbon metabolism
fsi01230  Biosynthesis of amino acids
fsi03018  RNA degradation
Module
fsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1085
   00030 Pentose phosphate pathway
    Flexsi_1085
   00051 Fructose and mannose metabolism
    Flexsi_1085
   00052 Galactose metabolism
    Flexsi_1085
  Energy metabolism
   00680 Methane metabolism
    Flexsi_1085
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Flexsi_1085
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Flexsi_1085
Protein phosphatases and associated proteins [BR:fsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Flexsi_1085
Messenger RNA biogenesis [BR:fsi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Flexsi_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DUF128 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEI14742
UniProt: F8E634
Position
1143822..1144784
Genome map
AA seq 320 aa AA seqDB search
MKRIAVMTSGGDCPGMNAAIRSVVRTALNYEMEVYGIEQGYSGLMEDQFIKLESRSVANM
IQRGGTFLRSARAPEFKEEEGQLKAMENLKNQGIEGLIVIGGDGSLAGAKVIHDKYHFPV
IGIPGSIDNDIYGTDMSIGVDTALNTILWCIDTINDTASSHDRTFIIEVMGRNCGYLALM
SAISGGAEAALIPEVPFKIENIIKKIKERYEEGKTRSVIILAEGVGSAGDFGKTFDMIGG
FETRITVLGHIQRGGSPTHFDRILATRMGASAVDSLLNGESGVMTALQERKIELVPLGEV
LNNKRKMDKKLLEIAEVLSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaattgcagtgatgacaagtggtggtgattgcccaggaatgaatgccgctatt
agaagtgtggtaagaactgctttgaactatgagatggaagtatacggtatagagcaaggt
tacagtggactgatggaagatcagtttattaaactcgaaagcagaagtgtagccaatatg
atacagagagggggaactttcctgagaagtgcccgggctccagaattcaaagaagaagaa
ggacagctgaaagcaatggagaatcttaaaaatcagggtatagaaggacttattgttata
gggggagatggttctctggctggtgccaaggtcatacatgataaatatcattttccggta
ataggtattcccgggtcaatagataacgacatatacggaacagatatgtctatcggagtg
gatactgctttaaacaccattttgtggtgtatagatactattaacgatacggcaagttca
catgacagaacatttataatagaagttatggggcgaaactgcggctatctagcccttatg
tctgcaataagcggaggtgcggaagcagctcttatcccggaagtcccttttaaaattgaa
aatatcatcaagaaaataaaagagagatacgaagagggaaaaacccgaagtgttataatt
ttggcagaaggagtgggttctgccggcgatttcggaaaaactttcgatatgataggcggt
tttgaaacgagaattaccgttttgggtcatatccaaagggggggcagccccacacatttt
gacaggattcttgcgaccagaatgggggcttctgcagtggattcactgcttaacggcgaa
agtggggtgatgaccgctttgcaggagagaaaaatagaacttgttcctctgggagaggtt
cttaacaacaaacgtaaaatggataaaaaacttttggaaattgcagaggtgctgagcaaa
taa

DBGET integrated database retrieval system