KEGG   Flexistipes sinusarabici: Flexsi_1085Help
Entry
Flexsi_1085       CDS       T01539                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Flexsi_1085
   01230 Biosynthesis of amino acids
    Flexsi_1085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1085
   00030 Pentose phosphate pathway
    Flexsi_1085
   00051 Fructose and mannose metabolism
    Flexsi_1085
   00052 Galactose metabolism
    Flexsi_1085
  Energy metabolism
   00680 Methane metabolism
    Flexsi_1085
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Flexsi_1085
Protein phosphatases and associated proteins [BR:fsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Flexsi_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143822..1144784
Genome map
AA seq 320 aa AA seqDB search
MKRIAVMTSGGDCPGMNAAIRSVVRTALNYEMEVYGIEQGYSGLMEDQFIKLESRSVANM
IQRGGTFLRSARAPEFKEEEGQLKAMENLKNQGIEGLIVIGGDGSLAGAKVIHDKYHFPV
IGIPGSIDNDIYGTDMSIGVDTALNTILWCIDTINDTASSHDRTFIIEVMGRNCGYLALM
SAISGGAEAALIPEVPFKIENIIKKIKERYEEGKTRSVIILAEGVGSAGDFGKTFDMIGG
FETRITVLGHIQRGGSPTHFDRILATRMGASAVDSLLNGESGVMTALQERKIELVPLGEV
LNNKRKMDKKLLEIAEVLSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaattgcagtgatgacaagtggtggtgattgcccaggaatgaatgccgctatt
agaagtgtggtaagaactgctttgaactatgagatggaagtatacggtatagagcaaggt
tacagtggactgatggaagatcagtttattaaactcgaaagcagaagtgtagccaatatg
atacagagagggggaactttcctgagaagtgcccgggctccagaattcaaagaagaagaa
ggacagctgaaagcaatggagaatcttaaaaatcagggtatagaaggacttattgttata
gggggagatggttctctggctggtgccaaggtcatacatgataaatatcattttccggta
ataggtattcccgggtcaatagataacgacatatacggaacagatatgtctatcggagtg
gatactgctttaaacaccattttgtggtgtatagatactattaacgatacggcaagttca
catgacagaacatttataatagaagttatggggcgaaactgcggctatctagcccttatg
tctgcaataagcggaggtgcggaagcagctcttatcccggaagtcccttttaaaattgaa
aatatcatcaagaaaataaaagagagatacgaagagggaaaaacccgaagtgttataatt
ttggcagaaggagtgggttctgccggcgatttcggaaaaactttcgatatgataggcggt
tttgaaacgagaattaccgttttgggtcatatccaaagggggggcagccccacacatttt
gacaggattcttgcgaccagaatgggggcttctgcagtggattcactgcttaacggcgaa
agtggggtgatgaccgctttgcaggagagaaaaatagaacttgttcctctgggagaggtt
cttaacaacaaacgtaaaatggataaaaaacttttggaaattgcagaggtgctgagcaaa
taa

DBGET integrated database retrieval system