KEGG   Flexistipes sinusarabici: Flexsi_1091Help
Entry
Flexsi_1091       CDS       T01539                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fsi  Flexistipes sinusarabici
Brite
Enzymes [BR:fsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Flexsi_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1149481..1150434
Genome map
AA seq 317 aa AA seqDB search
MNIYTNKKKTIFRWFILPWIIGLILIFLAVGLVTDMDKNLKPIVALDNVSSEELYQLDLK
RSYAEGVKLDENLPLYTEGTDNSVGILLIHGFTGSPYEMHELSAYLNSFGYSTYSVRLPG
SGTTPENLNEFTYKDWYESLKFGYFALKNSCNQVYVAGQSLGGLLASAVGYYNEVSGIIM
LNPAFKIKDWRFQFIPLMQLFNSISKKSDFDANYAGYFYDVWPLKGMYQLYLTQKYVKKK
LHDYDSPVLLVQAIEDEVVDYKGVLRYFENIKAKDKKKVLVEGKEDMHVLTLSKNSKQQF
VFEAISNWIKEKSNVQR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatttatacgaacaaaaaaaagacgattttcaggtggtttatactcccctggatt
atcggactgattttaatatttctggctgttggtttggttactgatatggataaaaaccta
aaacctattgttgctttggataacgtgagttccgaggaattgtaccagcttgatcttaaa
agaagctacgctgaaggggtaaagttggatgagaatcttcctctttatactgaaggaacc
gataattctgtcggaatccttttgatacacggttttacaggctccccttatgaaatgcac
gaactttcagcatatcttaacagtttcggatacagtacttattcagtaaggctgcccgga
agcggtacaactcctgaaaaccttaatgagtttacttataaagattggtatgaatctctg
aaattcggttatttcgcattgaaaaacagttgcaatcaggtttatgtggcgggacagtcc
cttggtggtcttctggcttctgctgtgggttattataacgaagtttcggggataataatg
ttgaatcctgcttttaaaatcaaggactggaggtttcagtttatccctttaatgcaatta
tttaatagtatttccaaaaaatctgattttgatgcaaattacgcaggttatttttacgat
gtctggccgttaaaaggcatgtatcagctttatttgacacagaaatatgtgaaaaagaaa
ttgcacgactatgactcgcccgttctcctggtgcaggctatagaagatgaagttgttgac
tacaaaggcgttttaagatattttgaaaatatcaaggcaaaagataagaaaaaagttctg
gttgagggcaaagaagatatgcatgtactcaccctcagtaaaaactcaaagcagcaattt
gtctttgaagctatcagtaattggataaaggagaagtcaaatgttcagcggtaa

DBGET integrated database retrieval system