KEGG   Flexistipes sinusarabici: Flexsi_1188Help
Entry
Flexsi_1188       CDS       T01539                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00330  Arginine and proline metabolism
fsi01100  Metabolic pathways
Module
fsi_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Flexsi_1188
Enzymes [BR:fsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Flexsi_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AEI14843
UniProt: F8E6K6
Position
1257694..1258530
Genome map
AA seq 278 aa AA seqDB search
MKTISNCFIGCDKSVEKSELLIFGAPYDGTSSFRPGSRFAPDKIREASYGLETYSPDYDM
DIEDLNVGDIGNVEFPFGEKDKVFKEIRSCTANLLDMNKKILCLGGEHLITLPIIEELSR
IHGNLKLIHMDAHADMRDTYISEKLSHATVLNNITELIGHKNIFHYGIRSGTREEFDKIA
KFNNLNMKNGKLSENIGDDPVYLTIDLDILDTSVLPGTGTPEPGGLTFKELSELLFSFKG
FNFVGADVVELAPDYDITGVSSIVAAKVVRNAICTLLS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgataagtaactgttttataggatgtgacaaatctgttgaaaaatccgagctg
cttatttttggcgcaccgtatgatggcacgagcagtttccgccccggctcaagatttgct
ccggataaaataagagaagcctcttacgggcttgaaacatacagccccgattacgatatg
gatatcgaagatttaaacgttggcgatataggcaatgtggaatttcctttcggtgaaaaa
gataaagtttttaaggaaataagaagttgtaccgctaatcttttggatatgaataaaaaa
atattatgtctcggaggggaacatcttataacactgcccattattgaggaactcagcagg
atacatggtaatttgaaactgatacatatggatgcacatgcagatatgcgtgatacatat
ataagtgaaaaactttcccatgctacagtattaaacaatatcactgaactaattggtcat
aaaaacatttttcattacggtattagaagcggaacacgggaagagtttgataagattgcc
aaattcaacaatctaaacatgaaaaacggcaaattgtctgaaaatatcggggatgatcct
gtttaccttacaattgatttggacatccttgacacatctgttcttcccggaacaggcaca
ccggaacccggcggacttacttttaaagaattatcggaactccttttctcctttaaaggc
tttaattttgtcggagctgatgtggtggagctggcacctgactatgacattaccggagta
tcaagtatagtagctgcaaaagtcgttagaaatgctatctgtacactattaagctaa

DBGET integrated database retrieval system