KEGG   Flexistipes sinusarabici: Flexsi_1293Help
Entry
Flexsi_1293       CDS       T01539                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Flexsi_1293
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Flexsi_1293
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Flexsi_1293
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Flexsi_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375265..1376611
Genome map
AA seq 448 aa AA seqDB search
MSKVFLDEKYIPDRWYNILADLPMPMDPPISPFTGKPVTFDEMKALFPPQLIEQEMSTQR
WIDIPEKVMEVMRLWRPTPLIRAERFEKALGVKSKIYFKYEGTSPAGSHKPNTAVAQAYY
NKINGINRLTTETGAGQWGSALSVACKMLEMQCRVFMVKVSFNQKPYRKSFMRMFDAEVI
PSPSEFTNAGREILKQNPESNGSLGLAISEAVEEAAGRDDTNYALGSVLNHVVLHQTVIG
LETKKQFELINDYPDKIFASCGGGSNFGGIAIPFIKDKLEGKDVEAIAVEPASCPTLTKG
RFAYDYGDVAKLTPIMKMYTLGHDFEPPAIHAGGLRYHGESPIVSHLYHEGIIDAQNVHQ
SDIFKYGIMFAQTEGIVPAPESAHAIAAAAMEAENNMEEGKEKSILFCLSGHGFFDMSAY
DAYFDGKLEDYEYPEEAIRKSLENLPNV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtttttcttgacgagaaatacatacctgatagatggtataatatactggct
gatcttcctatgcctatggacccgcccatcagcccttttaccggcaaacctgttacattc
gatgaaatgaaagcattattcccccctcagcttattgagcaggaaatgtccacacaaaga
tggattgatatacccgaaaaagtaatggaggtaatgcgtctttggagaccgacaccgttg
ataagggcagaaagatttgaaaaggcactcggtgtaaaatccaaaatctacttcaaatat
gaaggcacatcacctgccggaagccataaaccgaatactgcagtggctcaggcttattat
aacaaaataaacggaataaaccggttaaccactgaaactggggcaggccaatggggaagc
gcgttgtcagttgcctgcaaaatgcttgaaatgcagtgcagagtttttatggttaaagta
agcttcaaccaaaaaccgtacagaaaatcatttatgcgcatgtttgatgcggaagttatc
cccagtccttctgaatttacaaatgccggcagagaaatactgaaacagaatcccgaatcc
aatggaagtctcggacttgcaatcagtgaagctgtggaggaagctgcaggcagagatgat
acgaattacgctctgggcagcgttctgaatcatgttgttttgcaccagacagtaatagga
cttgaaacaaaaaaacaattcgagctgatcaatgattatccggacaaaatctttgcttcc
tgcggcggagggtctaattttggcggaatagccatcccttttataaaagacaagctggag
gggaaagatgtggaagcaattgcagttgagcccgcaagctgccccaccctcacaaaaggc
agatttgcttacgattacggcgatgtggcaaaactaactcctattatgaaaatgtacaca
ctgggacatgattttgagccgcctgcaatccatgcaggagggttgcgttatcacggcgaa
tctcctattgtcagccatctttaccatgaagggataatagatgcacagaatgttcaccaa
tctgatatattcaaatacggaataatgtttgcccagaccgaagggattgttcctgcaccg
gaatctgctcatgcaattgcggctgcggctatggaagctgaaaacaatatggaagaaggc
aaagaaaaatcaattcttttctgtctcagcggacacggtttctttgacatgtccgcttac
gacgcttatttcgacggcaaactcgaagattatgaatatcctgaagaagcaatcagaaaa
tcacttgaaaacttaccaaacgtttaa

DBGET integrated database retrieval system