KEGG   Flexistipes sinusarabici: Flexsi_1392Help
Entry
Flexsi_1392       CDS       T01539                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00330  Arginine and proline metabolism
fsi00332  Carbapenem biosynthesis
fsi01100  Metabolic pathways
fsi01130  Biosynthesis of antibiotics
fsi01230  Biosynthesis of amino acids
Module
fsi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Flexsi_1392
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Flexsi_1392
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Flexsi_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SIR2_2
Motif
Other DBs
NCBI-ProteinID: AEI15042
UniProt: F8E7X4
Position
complement(1487694..1488827)
Genome map
AA seq 377 aa AA seqDB search
MRKIPIIKTIVIKIGSNIITDQINGINQTFISELSGTISRVKEFAENVVIVSSGSVAAGF
RCLGYKSKPEDIIDKQACAAVGQTRLIRLYEKEFSKNNINVAQILLTKDDLSNRRRYLNA
RYTIRKLLEHGSIPIINENDSVVVDELKYIESFGDNDNLSALVAGLISADMLLILSDVEG
LFDKDPTKYADAKLVSEVKYVNNEMLNYAGDSVSGIGTGGMKSKIKAAKKALDSGCYVGI
INGNSTENVLKFLRGEETGTFFSHIEDPKNKKKLWLAYATIPKGDIVVDDGAVRAVRINK
KSLLPSGIVDVSGKFGIGDVVRIVNKNEEEIGRGKVRYSHFDLKKIMGRKTSEIYDILGY
KFSDEVIHRDDMVLEIT
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaattcctataataaaaacaattgttatcaagatcggcagcaatattataacc
gaccaaataaatggcataaaccagacctttatttccgaattatccgggacaatttctcgt
gtgaaagaatttgcagagaatgttgttatagtctcttccggctcagtagctgcgggtttt
cggtgtctcggatacaaatccaaacctgaagatataattgacaaacaggcatgcgcagcg
gttggccaaaccaggcttatccgtctttacgaaaaggaattcagtaaaaataatatcaat
gtcgcccagattcttttaaccaaagatgacttatcaaacagaagacgctacctcaatgca
agatacacaataagaaaattgcttgagcacggaagcataccgataataaatgagaatgac
tctgtggtggttgacgagttaaaatatatagaaagtttcggtgacaatgataatttatcc
gcccttgttgccggtctcatttcggcagatatgcttctgattttatctgatgtggagggg
ctttttgacaaagaccctacaaaatatgctgatgcaaaacttgtgagcgaagtaaaatat
gtcaataatgagatgcttaattacgccggtgactcggtttcgggtataggtacgggcgga
atgaagtccaagattaaagcagctaaaaaggctttggattcaggatgttatgtgggaata
atcaatggcaactccacagaaaatgttttgaaatttttaagaggagaggaaacgggaact
tttttttcacatattgaggatcccaaaaataaaaagaaattatggcttgcctatgctact
attcccaaaggtgatatagtggttgatgacggtgctgtaagagctgtcagaataaataaa
aaatctctgcttccttcgggtattgtggatgtttccggtaagttcggtattggtgatgtt
gttagaattgtaaataaaaatgaagaggaaattggaagaggtaaggtgcgttactcccat
tttgatctgaaaaagattatgggcaggaaaacctctgaaatttatgatattctcggctac
aaattcagcgatgaagtgattcatagagacgatatggtacttgaaattacttag

DBGET integrated database retrieval system