KEGG   Flexistipes sinusarabici: Flexsi_1468Help
Entry
Flexsi_1468       CDS       T01539                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fsi  Flexistipes sinusarabici
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Flexsi_1468
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Flexsi_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1567266..1567760)
Genome map
AA seq 164 aa AA seqDB search
MNTVFLGLGSNTYPKAKNLSSAIAGLSSLLNIISVSGVYKSRSLLLDAQPDYFNIVLKAS
TFINPCQLLSFCKTIEKIMHRDTPYKWGPRNIDIDIIDFGKRIVKSKSLFLPHKGFPYRN
FVVLPLMEIEPEYVHPENHISVEKMYDLLDNHSEIHRLGELKWR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtttttttggggttgggctcaaacacttatccgaaagccaaaaatctgtca
tctgctatcgcaggattgtcttctcttttgaatattatctccgtttcaggtgtttacaaa
agccggtcattgcttcttgatgctcagccggactactttaatattgtattaaaagcatca
acttttatcaatccttgtcagcttctttctttttgcaaaactattgagaagataatgcat
cgggataccccttacaaatggggacccagaaatattgatatcgatattattgattttggc
aaaaggattgttaaaagtaaatcactctttttgccccataaagggttcccgtacagaaat
tttgttgtcctgccgcttatggagattgagccggagtatgttcatccggagaatcatatt
agtgttgaaaaaatgtatgatttattggataatcacagtgagattcaccgtttgggagag
ttaaaatggcggtag

DBGET integrated database retrieval system