KEGG   Flexistipes sinusarabici: Flexsi_1527Help
Entry
Flexsi_1527       CDS       T01539                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fsi  Flexistipes sinusarabici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Flexsi_1527
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Flexsi_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634806..1635591
Genome map
AA seq 261 aa AA seqDB search
MQAEGKFWPTYIMKNSEKLLNRILITRQPEQSAEFVNLLSSRGLYPFILPMIETVPVECE
IKNKAFDYLIFTSSNAFNYFKKYINSIKFGKIAAVGKKTAEAIEREGFDVNLIPEDYSGE
GLVKKFMNREINGMKFLIPGPKKTSNTLKNFLVSKKAIVESPVVYETIGIQYPRGFISVF
IQENLIDCITFASPSAARSFLSQTKIPDTIKETVVIGRTTFSYLQENGINAVYPNKYTVS
DMVELICKINDEKNKLSGGTL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggaagggaaattttggccaacatatatcatgaagaatagtgaaaaactcctc
aacagaatccttataacccgccagccggaacagtccgcggagtttgtcaatctgctttct
tcccgcggtttgtaccctttcattctgcctatgattgaaactgtgccggttgaatgtgaa
attaaaaacaaggcatttgattaccttatcttcaccagctccaacgcatttaactatttt
aaaaaatatatcaacagtataaaattcggtaaaatagctgcagtaggcaaaaaaactgcc
gaagcaatagaaagggaaggttttgatgtaaatttaatcccggaggactacagcggagaa
ggtcttgtcaaaaaatttatgaacagggaaatcaacgggatgaagtttcttatccccggc
ccgaaaaaaacaagcaatacactgaaaaattttttagtatcgaaaaaggcaatagttgag
agccctgttgtttatgaaacgataggcatacaatacccccggggatttatttccgttttt
attcaggaaaatttgatagactgcatcacttttgcttccccttcagcagcccggagtttt
ctttcacagacaaaaataccagatacaataaaggaaactgtggttatcggcagaacaaca
ttcagttatcttcaggaaaacggtataaatgctgtatatccaaataaatacactgtgagt
gatatggttgaattgatatgcaaaattaatgatgaaaaaaataaactgtcaggaggaaca
ttatga

DBGET integrated database retrieval system