KEGG   Flexistipes sinusarabici: Flexsi_1528Help
Entry
Flexsi_1528       CDS       T01539                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fsi  Flexistipes sinusarabici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fsi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635588..1636556
Genome map
AA seq 322 aa AA seqDB search
MNFPVIRPRRLRKNETIRKMLRETKLSLDDLIYPMFVVEKPNVKKEIPSMPGIYQMCIEN
TVKECIQLEKLGVPAVILFGIPEHKDSKGSEAYNENGVIQKAVKAIKENTSNLYVITDVC
MCEYTDHGHCGIIKDKDVDNDETLKVLSLEALTHAKAGVDMVAPSDMMDGRVEAIRDILD
DNGFHNIPIMSYSAKYASAYYGPFRDAAESVPQFGDRRTYQMDPPNRLEAIREAELDIAE
GADIIMVKPALSYLDIIRDMKEHYNMPLAAYNVSGEYSMIMNAIEKGYFEKEKVIPETLT
SMKRAGADLILTYFAKTYAEMM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccccgttatcagaccaagaaggttgagaaaaaatgagacaataagaaaaatg
ctgagagaaacaaaactgagtctggatgatcttatatacccgatgtttgttgtggaaaag
cccaatgtaaaaaaagaaatcccctcaatgccgggaatctatcagatgtgcatagaaaat
accgtaaaggaatgcatccagctggaaaaacttggcgtgcccgcagttatccttttcggt
attccggagcacaaggacagtaaagggtctgaggcatacaacgaaaacggtgtgattcaa
aaggctgtcaaagccattaaggaaaatacgtcaaatttatatgtaataaccgatgtctgt
atgtgcgagtacacagaccacgggcactgtggaataataaaagataaagatgttgacaac
gacgaaacactgaaagtattaagtttggaagctctgacacacgcaaaagccggtgtggat
atggttgctcccagtgacatgatggacggaagggtcgaggcaataagggatatactggat
gataacggatttcacaacattcccataatgagctattcagccaagtacgcctcagcatac
tacggtcctttccgtgatgctgcagaaagtgtcccgcaattcggtgacaggagaacttat
cagatggatcccccaaacagactggaggcaattagagaagccgaactggatatagcagaa
ggtgcagacattataatggtaaaacctgcactctcatatctggatattatcagagatatg
aaagagcattataatatgcctcttgccgcatacaatgtaagtggcgaatactccatgatt
atgaatgctattgaaaagggatattttgaaaaagaaaaagtcattcctgaaacacttaca
tcaatgaaaagggcaggtgctgatctcatattgacgtattttgccaagacttatgcagaa
atgatgtag

DBGET integrated database retrieval system