KEGG   Flexistipes sinusarabici: Flexsi_1528Help
Entry
Flexsi_1528       CDS       T01539                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fsi  Flexistipes sinusarabici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Flexsi_1528
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Flexsi_1528
Exosome [BR:fsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Flexsi_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635588..1636556
Genome map
AA seq 322 aa AA seqDB search
MNFPVIRPRRLRKNETIRKMLRETKLSLDDLIYPMFVVEKPNVKKEIPSMPGIYQMCIEN
TVKECIQLEKLGVPAVILFGIPEHKDSKGSEAYNENGVIQKAVKAIKENTSNLYVITDVC
MCEYTDHGHCGIIKDKDVDNDETLKVLSLEALTHAKAGVDMVAPSDMMDGRVEAIRDILD
DNGFHNIPIMSYSAKYASAYYGPFRDAAESVPQFGDRRTYQMDPPNRLEAIREAELDIAE
GADIIMVKPALSYLDIIRDMKEHYNMPLAAYNVSGEYSMIMNAIEKGYFEKEKVIPETLT
SMKRAGADLILTYFAKTYAEMM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccccgttatcagaccaagaaggttgagaaaaaatgagacaataagaaaaatg
ctgagagaaacaaaactgagtctggatgatcttatatacccgatgtttgttgtggaaaag
cccaatgtaaaaaaagaaatcccctcaatgccgggaatctatcagatgtgcatagaaaat
accgtaaaggaatgcatccagctggaaaaacttggcgtgcccgcagttatccttttcggt
attccggagcacaaggacagtaaagggtctgaggcatacaacgaaaacggtgtgattcaa
aaggctgtcaaagccattaaggaaaatacgtcaaatttatatgtaataaccgatgtctgt
atgtgcgagtacacagaccacgggcactgtggaataataaaagataaagatgttgacaac
gacgaaacactgaaagtattaagtttggaagctctgacacacgcaaaagccggtgtggat
atggttgctcccagtgacatgatggacggaagggtcgaggcaataagggatatactggat
gataacggatttcacaacattcccataatgagctattcagccaagtacgcctcagcatac
tacggtcctttccgtgatgctgcagaaagtgtcccgcaattcggtgacaggagaacttat
cagatggatcccccaaacagactggaggcaattagagaagccgaactggatatagcagaa
ggtgcagacattataatggtaaaacctgcactctcatatctggatattatcagagatatg
aaagagcattataatatgcctcttgccgcatacaatgtaagtggcgaatactccatgatt
atgaatgctattgaaaagggatattttgaaaaagaaaaagtcattcctgaaacacttaca
tcaatgaaaagggcaggtgctgatctcatattgacgtattttgccaagacttatgcagaa
atgatgtag

DBGET integrated database retrieval system